Strategien für die Biotechnologie müssen Möglichkeiten für Forschung, Innovation und Unternehmenswachstum berücksichtigen. Auf regionaler Ebene bieten öffentlich-private Kooperationen Potenzial für ein solches Wachstum und die Schaffung von Kompetenzzentren. Unter Berücksichtigung der jüngsten Fortschritte in Bereichen wie Genomik, Gesundheitsdiagnostik, synthetische Biologie, Geneditierung und bio-digitale Technologien werden Möglichkeiten für intelligente, strategische und spezialisierte Investitionen erörtert.
Diese Möglichkeiten beinhalten häufig konvergente oder disruptive Technologien, die beispielsweise Elemente der Pharma-Wissenschaft, der Molekularbiologie, der Bioinformatik und der Entwicklung neuartiger Geräte kombinieren, um die Biotechnologie und die Biowissenschaften zu verbessern. Analytische Anwendungen verwenden neuartige Geräte für die mobile Gesundheit, die prädiktive Diagnostik und die geschichtete Medizin. Die synthetische Biologie bietet Möglichkeiten für die Entwicklung neuer Produkte und die Steigerung der Effizienz bestehender Prozesse. Erfolgreiche Kompetenzzentren sollten öffentlich-private Geschäftspartnerschaften, Clustering und globale Kooperationen fördern, die auf Spitzenleistungen, intelligenten Strategien und Innovationen beruhen, um langfristig nachhaltig zu bleiben.
Eine der größten Herausforderungen für die Biotechnologie- und Pharmaunternehmen im 21. Jahrhundert wird die Entwicklung und Lieferung von Arzneimitteln sein, die der Biologie und Pathophysiologie des einzelnen Patienten entsprechen. Dieser Wechsel von der Blockbuster-Medizin zur personalisierten Medizin wird in hohem Maße die Art und Weise beeinflussen, wie Medikamente in Zukunft entwickelt, vermarktet und verschrieben werden. Diese Änderungen könnten ein Ende der Blockbuster-Philosophie in „Big Pharma“ bedeuten und damit wesentliche Änderungen in den Unternehmensstrukturen nach sich ziehen. Die Implementierung der personalisierten Medizin wird ein schrittweiser Prozess sein, bei dem die Aufteilung der Patienten in biologische Untergruppen der erste wichtige Schritt sein wird. Dies ist bereits heute bei mehreren Krebserkrankungen der Fall, beispielsweise bei Brustkrebs. In den kommenden Jahren werden aufgrund der Ergebnisse pharmakodiagnostischer Tests immer mehr Medikamente verschrieben. In der Krebsmedizin, die auf diesem Gebiet führend war, wird erwartet, dass in 10 bis 15 Jahren nur sehr wenige Medikamente ohne einen solchen Test verschrieben werden.
Erfolg in Open Science definieren.
Immer mehr Beweise deuten darauf hin, dass Innovationssysteme weltweit zunehmend nicht mehr nachhaltig sind. Ebenso bestehen weiterhin Bedenken hinsichtlich der Ungleichheiten im Wissenschafts- und Innovationsprozess und des Zugangs zu seinen Vorteilen. Vor dem Hintergrund wachsender gesundheitlicher, wirtschaftlicher und wissenschaftlicher Herausforderungen versuchen globale Interessengruppen dringend, Innovationen voranzutreiben und die gerechte Verteilung der Vorteile für alle zu maximieren. Die Open Science Collaboration (OS), die eine Vielzahl von Ansätzen umfasst, um die offene, öffentliche und schnelle Mobilisierung wissenschaftlicher Erkenntnisse zu verbessern, wird als einer der vielversprechendsten Wege in die Zukunft angesehen. Viele Entscheidungsträger zögern jedoch, eine Politik zu entwickeln, die die Annahme und Implementierung von Betriebssystemen unterstützt, ohne Zugang zu substanziellen, klaren und verlässlichen Beweisen zu haben.
Im Oktober 2017 versammelten sich internationale Vordenker auf einem Open Science Leadership Forum in den Büros der Bill and Melinda Gates Foundation in Washington DC, um ihre Ansichten darüber zu teilen, wie erfolgreich Open Science aussieht. Delegierte aus Industrie- und Entwicklungsländern, nationalen Regierungen, Wissenschaftsagenturen und Förderorganisationen, Philanthropie, Forschern, Patientenorganisationen und der Biotechnologie-, Pharma- und Künstlichen Intelligenz (KI) -Industrie diskutierten die Ergebnisse, die sie dazu bringen würden, in OS und darüber hinaus zu investieren Fragen der Politik und Umsetzung. Dieser erste von zwei Berichten fasst die Ansichten der Delegierten darüber zusammen, was OS ihrer Meinung nach in Bezug auf Forschung, Innovation und soziale Auswirkungen in den Biowissenschaften leisten wird.
Durch einen offenen und kollaborativen Prozess in den nächsten Monaten werden wir diese Erfolgsergebnisse in ein Toolkit quantitativer und qualitativer Indikatoren umsetzen, um zu bewerten, wann, wo und wie offene wissenschaftliche Kooperationen Forschung, Innovation und sozialen Nutzen am besten fördern. Letztendlich zielt diese Arbeit darauf ab, Instrumente zu entwickeln und offen auszutauschen, die es den Stakeholdern ermöglichen, ihre Innovationsökosysteme zu bewerten und neu zu erfinden, den Wert für die globale Öffentlichkeit und die Patienten zu maximieren und langjährige Fragen zu den Mechanismen der Innovation zu beantworten.

Impfstoffherstellung und -technologie: von biotechnologischen Plattformen bis zu syntethischen Epitopen, aktueller Standpunkt.
Die Ziele: Die Überprüfung berücksichtigt die kurze Geschichte der Impfpraxis und die Entwicklung der Impfstofftechnologie. ‘In die Überprüfung beziehen wir Daten aus mehreren Monographien über die Herstellung von Impfstoffen ein, die von Autoren von Unternehmen wie Merck & Co; Sanofi Pasteur; Dynavax Europe / Rhein Biotech GmbH; Latham Biopharm Group; Aridis Pharmaceuticals LLC; Genentech; Amgen; Shamir Biologics LLC; Biopharm Services US; Novartis Pharma AG und mehrere Forschungszentren: Labor für bakterielle Polysaccharide, Zentrum für Bewertung und Forschung von Biologika; Purdue University, West Lafayette, IN, USA; Institut für Pharmazeutische Chemie, Univ. Von Kansas; Max-Planck-Institut für Dynamik komplexer technischer Systeme; Fraunhofer USA Zentrum für Molekulare Biotechnologie; US Dep. of Agriculture Tier- und Pflanzengesundheitsinspektionsdienst usw.
Impfstoffherstellung und -technologie: von biotechnologischen Plattformen bis zu syntethischen Epitopen, aktueller Standpunkt.
Die Ziele: Die Überprüfung berücksichtigt die kurze Geschichte der Impfpraxis und die Entwicklung der Impfstofftechnologie. In die Überprüfung beziehen wir Daten aus mehreren Monographien über die Herstellung von Impfstoffen ein, die von Autoren von Unternehmen wie Merck & Co; Sanofi Pasteur; Dynavax Europe / Rhein Biotech GmbH; Latham Biopharm Group; Aridis Pharmaceuticals LLC; Genentech; Amgen; Shamir Biologics LLC; Biopharm Services US; Novartis Pharma AG und mehrere Forschungszentren: Labor für bakterielle Polysaccharide, Zentrum für Bewertung und Forschung von Biologika; Purdue University, West Lafayette, IN, USA; Institut für Pharmazeutische Chemie, Univ. Von Kansas; Max-Planck-Institut für Dynamik komplexer technischer Systeme; Fraunhofer USA Zentrum für Molekulare Biotechnologie; US Dep. of Agriculture Tier- und Pflanzengesundheitsinspektionsdienst usw.
In der historischen Literatur gibt es Daten über Impfpraktiken im antiken China, Persien, Indien, Byzanz, amerikanischen Ureinwohnern und einigen afrikanischen Bevölkerungsgruppen. In der modernen Immunologie wurden die Impfstoffe seit dem Ende des 19. Jahrhunderts auf den In-vivo-Plattformen hergestellt – bei Tieren (Kaninchen, Mäusen, Kühen). Seit 1931 wurden und werden aufgrund der Entwicklung von E. Goodpasture die meisten Virusimpfstoffe auf der in ovo-Plattform hergestellt. 1949 entwickelte J. F. Enders in vitro eine Produktion von Polio-Viren in großem Maßstab in der Primärkultur von Affennierenzellen.
Lyophilized recombinant standard |
ST0000-1 |
BosterBio |
1ng/vial |
EUR 172 |
FDA Standard Tissue Array |
T8234701-1 |
Biochain |
1 slides |
EUR 214 |
Description: Our tissue products are produced by strictly following the IRB ethical standards and procedures and from highest quality tissues. Immediately after collection the tissues are placed in liquid nitrogen and examined by certified pathologists. The thickness of each individual section is ~5um. They are Hematoxylin and Eosin stained and quality tested by immunostaining with anti-beta-actin antibodies. Our tissue products are suitable for various studies on cellular level (RNA localization, Protein expression, etc.) on both normal and pathological cases. It is also an excellent control and educational tool. |
FDA Standard Frozen Tissue Array - Mouse Normal |
T6334701-1 |
Biochain |
2 slides |
EUR 599 |
Description: Our tissue products are produced by strictly following the IRB ethical standards and procedures and from highest quality tissues. Immediately after collection the tissues are placed in liquid nitrogen and examined by certified pathologists. The thickness of each individual section is ~5um. They are Hematoxylin and Eosin stained and quality tested by immunostaining with anti-beta-actin antibodies. Our tissue products are suitable for various studies on cellular level (RNA localization, Protein expression, etc.) on both normal and pathological cases. It is also an excellent control and educational tool. |
FDA Standard Frozen Tissue Array - Rat Normal |
T6434701-1 |
Biochain |
2 slides |
EUR 599 |
Description: Our tissue products are produced by strictly following the IRB ethical standards and procedures and from highest quality tissues. Immediately after collection the tissues are placed in liquid nitrogen and examined by certified pathologists. The thickness of each individual section is ~5um. They are Hematoxylin and Eosin stained and quality tested by immunostaining with anti-beta-actin antibodies. Our tissue products are suitable for various studies on cellular level (RNA localization, Protein expression, etc.) on both normal and pathological cases. It is also an excellent control and educational tool. |
Standard |
abx092106-1vial |
Abbexa |
1 vial |
EUR 217 |
- Shipped within 5-12 working days.
|
Standard |
abx098954-10vials |
Abbexa |
10 vials |
EUR 2179 |
- Shipped within 5-7 working days.
|
Standard |
abx098954-1vial |
Abbexa |
1 vial |
EUR 300 |
- Shipped within 5-7 working days.
|
Standard |
abx098954-5vials |
Abbexa |
5 vials |
EUR 1177 |
- Shipped within 5-7 working days.
|
Standard |
abx098955-10vials |
Abbexa |
10 vials |
EUR 2179 |
- Shipped within 5-7 working days.
|
Standard |
abx098955-1vial |
Abbexa |
1 vial |
EUR 300 |
- Shipped within 5-7 working days.
|
Standard |
abx098955-5vials |
Abbexa |
5 vials |
EUR 1177 |
- Shipped within 5-7 working days.
|
Standard |
abx098956-10vials |
Abbexa |
10 vials |
EUR 2179 |
- Shipped within 5-7 working days.
|
Standard |
abx098956-1vial |
Abbexa |
1 vial |
EUR 300 |
- Shipped within 5-7 working days.
|
Standard |
abx098956-5vials |
Abbexa |
5 vials |
EUR 1177 |
- Shipped within 5-7 working days.
|
Standard |
abx098963-10vials |
Abbexa |
10 vials |
EUR 2179 |
- Shipped within 5-7 working days.
|
Standard |
abx098963-1vial |
Abbexa |
1 vial |
EUR 300 |
- Shipped within 5-7 working days.
|
Standard |
abx098963-5vials |
Abbexa |
5 vials |
EUR 1177 |
- Shipped within 5-7 working days.
|
Standard |
abx098965-10vials |
Abbexa |
10 vials |
EUR 2179 |
- Shipped within 5-7 working days.
|
Standard |
abx098965-1vial |
Abbexa |
1 vial |
EUR 300 |
- Shipped within 5-7 working days.
|
Standard |
abx098965-5vials |
Abbexa |
5 vials |
EUR 1177 |
- Shipped within 5-7 working days.
|
Standard |
abx098967-10vials |
Abbexa |
10 vials |
EUR 2179 |
- Shipped within 5-7 working days.
|
Standard |
abx098967-1vial |
Abbexa |
1 vial |
EUR 300 |
- Shipped within 5-7 working days.
|
Standard |
abx098967-5vials |
Abbexa |
5 vials |
EUR 1177 |
- Shipped within 5-7 working days.
|
Standard |
abx098968-10vials |
Abbexa |
10 vials |
EUR 2179 |
- Shipped within 5-7 working days.
|
Standard |
abx098968-1vial |
Abbexa |
1 vial |
EUR 300 |
- Shipped within 5-7 working days.
|
Standard |
abx098968-5vials |
Abbexa |
5 vials |
EUR 1177 |
- Shipped within 5-7 working days.
|
Standard |
abx098969-10vials |
Abbexa |
10 vials |
EUR 2179 |
- Shipped within 5-7 working days.
|
Standard |
abx098969-1vial |
Abbexa |
1 vial |
EUR 300 |
- Shipped within 5-7 working days.
|
Standard |
abx098969-5vials |
Abbexa |
5 vials |
EUR 1177 |
- Shipped within 5-7 working days.
|
Standard |
abx296006-1vial |
Abbexa |
1 vial |
EUR 300 |
- Shipped within 5-10 working days.
|
FDA Standard Frozen Tissue Array - Human Adult Normal |
T6234701-1 |
Biochain |
2 slides |
EUR 1120 |
Description: Our tissue products are produced by strictly following the IRB ethical standards and procedures and from highest quality tissues. Immediately after collection the tissues are placed in liquid nitrogen and examined by certified pathologists. The thickness of each individual section is ~5um. They are Hematoxylin and Eosin stained and quality tested by immunostaining with anti-beta-actin antibodies. Our tissue products are suitable for various studies on cellular level (RNA localization, Protein expression, etc.) on both normal and pathological cases. It is also an excellent control and educational tool. |
Endothelin-1 Standard, 50UL |
C160-50UL |
Arbor Assays |
50UL |
EUR 123 |
Human Plasma Progesterone standard (100 ng/ml) |
1955-P4-1 |
Alpha Diagnostics |
1 ml |
Ask for price |
Amyloid ?-Peptide (1-42) (human) |
B6057-.1 |
ApexBio |
100 ug |
EUR 276 |
HIV-1 Tat Protein Peptide |
B1433-1 |
ApexBio |
1 mg |
EUR 128 |
Description: HIV-1 Tat Protein Peptide |
Standard G. Pig Complement serum (Lyophilized), tested for complement activity |
COMPG-1 |
Alpha Diagnostics |
1 ml |
EUR 225 |
Deoxynivalenol Standard |
SD010 |
Unibiotest |
0.5ug/mL |
EUR 607 |
Zearalenone Standard |
SD013 |
Unibiotest |
0.5ug/mL |
EUR 523 |
Tetrodotoxin Standard |
SD015 |
Unibiotest |
0.5ug/mL |
EUR 607 |
Microcystin Standard |
SD016 |
Unibiotest |
0.5ug/mL |
EUR 523 |
Brain natriuretic peptide (1-32) (human) |
B5442-1 |
ApexBio |
1 mg |
EUR 518 |
Amyloid Beta-Peptide (1-40) (human) |
A1124-1 |
ApexBio |
1 mg |
EUR 189 |
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
YAP-TEAD Inhibitor 1 (Peptide 17) |
A1149-1 |
ApexBio |
1 mg |
EUR 235 |
GnRH Associated Peptide (GAP) (1-13), human |
A1020-1 |
ApexBio |
1 mg |
EUR 90 |
Description: Sequence: Asp-Ala-Glu-Asn-Leu-Ile-Asp-Ser-Phe-Gln-Glu-Ile-ValThe cloned complementary DNA sequence encoding the human gonadotropin-releasing hormone (GnRH) precursor protein was used to construct an expression vector for the bacterial synthesis of the 56-amino acid GnRH-associated peptide (GAP). |
SAMS Peptide |
B5097-1 |
ApexBio |
1 mg |
EUR 222 |
Rhodopsin peptide |
A1087-1 |
ApexBio |
1 mg |
EUR 131 |
Description: Rhodopsin peptide,(C51H88N14O20), a peptide with the sequence H2N-Val-Ser-Lys-Thr-Glu-Thr-Ser-Gln-Val-Ala-Pro-Ala-OH, MW= 1217.33. Rhodopsin, also known as visual purple, is a biological pigment in photoreceptor cells of the retina that is responsible for the first events in the perception of light. |
Peptide Standard 1 [H-Cys-Pro-Asp-Phe-Gly-His-Ile-Ala-Met-Glu-Leu-Ser-Val-Arg-Thr-Trp-Lys-Tyr-OH; MW: 2152.52] |
SP-55163-1 |
Alpha Diagnostics |
0.5 mg |
EUR 166 |
ExoStd? BPH-1 Fluorescent Exosome Standard |
M1087-100 |
Biovision |
|
EUR 756 |
Canine C-Peptide ELISA Kit |
DLR-C-Peptide-c-48T |
DL Develop |
48T |
EUR 527 |
- Should the Canine C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Canine C-Peptide ELISA Kit |
DLR-C-Peptide-c-96T |
DL Develop |
96T |
EUR 688 |
- Should the Canine C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Human C-Peptide ELISA Kit |
DLR-C-Peptide-Hu-48T |
DL Develop |
48T |
EUR 398 |
- Should the Human C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Human C-Peptide ELISA Kit |
DLR-C-Peptide-Hu-96T |
DL Develop |
96T |
EUR 511 |
- Should the Human C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Mouse C-Peptide ELISA Kit |
DLR-C-Peptide-Mu-48T |
DL Develop |
48T |
EUR 450 |
- Should the Mouse C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Mouse C-Peptide ELISA Kit |
DLR-C-Peptide-Mu-96T |
DL Develop |
96T |
EUR 582 |
- Should the Mouse C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Rat C-Peptide ELISA Kit |
DLR-C-Peptide-Ra-48T |
DL Develop |
48T |
EUR 467 |
- Should the Rat C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Rat C-Peptide ELISA Kit |
DLR-C-Peptide-Ra-96T |
DL Develop |
96T |
EUR 605 |
- Should the Rat C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Canine C-Peptide ELISA Kit |
RD-C-Peptide-c-48Tests |
Reddot Biotech |
48 Tests |
EUR 533 |
Canine C-Peptide ELISA Kit |
RD-C-Peptide-c-96Tests |
Reddot Biotech |
96 Tests |
EUR 740 |
Human C-Peptide ELISA Kit |
RD-C-Peptide-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 387 |
Human C-Peptide ELISA Kit |
RD-C-Peptide-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 532 |
Mouse C-Peptide ELISA Kit |
RD-C-Peptide-Mu-48Tests |
Reddot Biotech |
48 Tests |
EUR 446 |
Mouse C-Peptide ELISA Kit |
RD-C-Peptide-Mu-96Tests |
Reddot Biotech |
96 Tests |
EUR 615 |
Rat C-Peptide ELISA Kit |
RD-C-Peptide-Ra-48Tests |
Reddot Biotech |
48 Tests |
EUR 465 |
Rat C-Peptide ELISA Kit |
RD-C-Peptide-Ra-96Tests |
Reddot Biotech |
96 Tests |
EUR 643 |
Canine C-Peptide ELISA Kit |
RDR-C-Peptide-c-48Tests |
Reddot Biotech |
48 Tests |
EUR 557 |
Canine C-Peptide ELISA Kit |
RDR-C-Peptide-c-96Tests |
Reddot Biotech |
96 Tests |
EUR 774 |
Human C-Peptide ELISA Kit |
RDR-C-Peptide-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 404 |
Human C-Peptide ELISA Kit |
RDR-C-Peptide-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 556 |
Mouse C-Peptide ELISA Kit |
RDR-C-Peptide-Mu-48Tests |
Reddot Biotech |
48 Tests |
EUR 465 |
Mouse C-Peptide ELISA Kit |
RDR-C-Peptide-Mu-96Tests |
Reddot Biotech |
96 Tests |
EUR 643 |
Rat C-Peptide ELISA Kit |
RDR-C-Peptide-Ra-48Tests |
Reddot Biotech |
48 Tests |
EUR 486 |
Rat C-Peptide ELISA Kit |
RDR-C-Peptide-Ra-96Tests |
Reddot Biotech |
96 Tests |
EUR 672 |
GLP-1 Glucagon Like Peptide-1 (31 a.a.) Human Recombinant Protein |
PROTP01275-1 |
BosterBio |
Regular: 50ug |
EUR 317 |
Description: Glucagon Like Peptide-1 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 31 amino acids and having a molecular mass of 3298.7 Dalton. The GLP-1 is purified by proprietary chromatographic techniques. |
Formaldehyde Standard, 500UL |
C001-500UL |
Arbor Assays |
500UL |
EUR 123 |
Creatinine Standard, 100UL |
C003-100UL |
Arbor Assays |
100UL |
EUR 123 |
Palladium Standard, 100UL |
C016-100UL |
Arbor Assays |
100UL |
EUR 123 |
Glutathione Standard, 100UL |
C018-100UL |
Arbor Assays |
100UL |
EUR 122 |
Glutathione Standard, 300UL |
C018-300UL |
Arbor Assays |
300UL |
EUR 123 |
Hemoglobin Standard, 300UL |
C037-300UL |
Arbor Assays |
300UL |
EUR 123 |
Cortisol Standard, 125UL |
C040-125UL |
Arbor Assays |
125UL |
EUR 123 |
Cortisol Standard, 625UL |
C040-625UL |
Arbor Assays |
625UL |
EUR 227 |
Corticosterone Standard, 125UL |
C043-125UL |
Arbor Assays |
125UL |
EUR 123 |
Corticosterone Standard, 625UL |
C043-625UL |
Arbor Assays |
625UL |
EUR 227 |
Acetylcholinesterase Standard, 225UL |
C046-225UL |
Arbor Assays |
225UL |
EUR 123 |
Butyrylcholinesterase Standard, 225UL |
C051-225UL |
Arbor Assays |
225UL |
EUR 123 |
Cortisone Standard, 125UL |
C054-125UL |
Arbor Assays |
125UL |
EUR 227 |
Cortisone Standard, 50UL |
C054-50UL |
Arbor Assays |
50UL |
EUR 123 |
Cortisone Standard, 625UL |
C054-625UL |
Arbor Assays |
625UL |
EUR 227 |
Nitrate Standard, 200UL |
C086-200UL |
Arbor Assays |
200UL |
EUR 123 |
Nitrite Standard, 200UL |
C087-200UL |
Arbor Assays |
200UL |
EUR 123 |
Progesterone Standard, 125UL |
C092-125UL |
Arbor Assays |
125UL |
EUR 123 |
Progesterone Standard, 625UL |
C092-625UL |
Arbor Assays |
625UL |
EUR 237 |
Estradiol Standard, 125UL |
C103-125UL |
Arbor Assays |
125UL |
EUR 123 |
Estradiol Standard, 625UL |
C103-625UL |
Arbor Assays |
625UL |
EUR 237 |
Estrone Standard, 125UL |
C110-125UL |
Arbor Assays |
125UL |
EUR 123 |
Estrone Standard, 625UL |
C110-625UL |
Arbor Assays |
625UL |
EUR 237 |
Testosterone Standard, 350UL |
C113-350UL |
Arbor Assays |
350UL |
EUR 237 |
Testosterone Standard, 70UL |
C113-70UL |
Arbor Assays |
70UL |
EUR 123 |
Galactose Standard, 90UL |
C146-90UL |
Arbor Assays |
90UL |
EUR 123 |
Corticosterone Standard, 125UL |
C151-125UL |
Arbor Assays |
125UL |
EUR 123 |
Corticosterone Standard, 625UL |
C151-625UL |
Arbor Assays |
625UL |
EUR 227 |
Allopregnanolone Standard, 125UL |
C155-125UL |
Arbor Assays |
125UL |
EUR 123 |
Allopregnanolone Standard, 625UL |
C155-625UL |
Arbor Assays |
625UL |
EUR 227 |
Estradiol Standard, 375UL |
C158-375UL |
Arbor Assays |
375UL |
EUR 227 |
Estradiol Standard, 75UL |
C158-75UL |
Arbor Assays |
75UL |
EUR 122 |
Oxytocin Standard, 125UL |
C164-125UL |
Arbor Assays |
125UL |
EUR 123 |
Oxytocin Standard, 625UL |
C164-625UL |
Arbor Assays |
625UL |
EUR 237 |
Oxytocin Standard, 125UL |
C167-125UL |
Arbor Assays |
125UL |
EUR 123 |
Oxytocin Standard, 625UL |
C167-625UL |
Arbor Assays |
625UL |
EUR 227 |
Thyroxine Standard, 200UL |
C177-200UL |
Arbor Assays |
200UL |
EUR 227 |
Thyroxine Standard, 40UL |
C177-40UL |
Arbor Assays |
40UL |
EUR 123 |
Aldosterone Standard, 125UL |
C182-125UL |
Arbor Assays |
125UL |
EUR 123 |
Aldosterone Standard, 625UL |
C182-625UL |
Arbor Assays |
625UL |
EUR 227 |
Ceruloplasmin Standard, 20UL |
C189-20UL |
Arbor Assays |
20UL |
EUR 163 |
Levonorgestrel Standard, 350UL |
C219-350UL |
Arbor Assays |
350UL |
EUR 227 |
Levonorgestrel Standard, 70UL |
C219-70UL |
Arbor Assays |
70UL |
EUR 123 |
Myeloperoxidase Standard, 70UL |
C225-70UL |
Arbor Assays |
70UL |
EUR 123 |
Epiandrosterone Standard, 125UL |
C233-125UL |
Arbor Assays |
125UL |
EUR 123 |
Epiandrosterone Standard, 625UL |
C233-625UL |
Arbor Assays |
625UL |
EUR 227 |
Estriol Standard, 125UL |
C236-125UL |
Arbor Assays |
125UL |
EUR 123 |
Estriol Standard, 625UL |
C236-625UL |
Arbor Assays |
625UL |
EUR 227 |
Progesterone Standard, 200UL |
C252-200UL |
Arbor Assays |
200UL |
EUR 237 |
Progesterone Standard, 40UL |
C252-40UL |
Arbor Assays |
40UL |
EUR 123 |
CHO HCP Standard |
F018G |
Cygnus Technologies |
1 ml |
EUR 257 |
- Product category: Quality control/standard for molecular biology applications
|
Description: CHO HCP Standard by Cygnus Technologies is available in Europe via Gentaur. |
BSA Standard E |
F031E |
Cygnus Technologies |
1 ml |
EUR 195 |
- Product category: Quality control/standard for molecular biology applications
|
Description: BSA Standard E by Cygnus Technologies is available in Europe via Gentaur. |
Insulin Standard G |
F043G |
Cygnus Technologies |
1 ml |
EUR 195 |
- Product category: Quality control/standard for molecular biology applications
|
Description: Insulin Standard G by Cygnus Technologies is available in Europe via Gentaur. |
ExoStepTM Culture + Standard |
ExoS-25-CST9 |
ImmunoStep |
25 test |
EUR 726 |
ExoStepTM Plasma + Standard |
ExoS-25-PST81 |
ImmunoStep |
25 test |
EUR 726 |
ExoStepTM Urine + Standard |
ExoS-25-UST9 |
ImmunoStep |
25 test |
EUR 726 |
Standard Diluent Buffer |
abx098951-20ml |
Abbexa |
20 ml |
EUR 91 |
- Shipped within 5-7 working days.
|
HiQTM Standard Agarose |
A0222-020 |
GenDepot |
200g |
EUR 250 |
Bis heute wird die Primärkultur von Chiken-Embrio-Fibroblasten zur Produktion von Impfviren gegen Masern, Mumps und Tollwut in großem Maßstab verwendet. Seit dem 2000. Jahr in westlichen Ländern wurde der größte Teil der Virusimpfstoffe durch Kultivierung in kontinuierlichen Tumorzelllinien hergestellt. Die letzte Technologie ist die kostengünstigste für die Herstellung von Impfstoffen in großem Maßstab. Wir überprüfen mehrere neue biotechnologische Plattformen für die Herstellung des rekombinanten Proteins oder virusähnlicher Partikel als Impfstoffe für Untereinheiten: Pflanzensystem, Algen, Pilze, Insektenzellen usw.