Menu Close

Chancen in der Biotechnologie.

Chancen in der Biotechnologie.


Strategien für die Biotechnologie müssen Möglichkeiten für Forschung, Innovation und Unternehmenswachstum berücksichtigen. Auf regionaler Ebene bieten öffentlich-private Kooperationen Potenzial für ein solches Wachstum und die Schaffung von Kompetenzzentren. Unter Berücksichtigung der jüngsten Fortschritte in Bereichen wie Genomik, Gesundheitsdiagnostik, synthetische Biologie, Geneditierung und bio-digitale Technologien werden Möglichkeiten für intelligente, strategische und spezialisierte Investitionen erörtert.

Diese Möglichkeiten beinhalten häufig konvergente oder disruptive Technologien, die beispielsweise Elemente der Pharma-Wissenschaft, der Molekularbiologie, der Bioinformatik und der Entwicklung neuartiger Geräte kombinieren, um die Biotechnologie und die Biowissenschaften zu verbessern. Analytische Anwendungen verwenden neuartige Geräte für die mobile Gesundheit, die prädiktive Diagnostik und die geschichtete Medizin. Die synthetische Biologie bietet Möglichkeiten für die Entwicklung neuer Produkte und die Steigerung der Effizienz bestehender Prozesse. Erfolgreiche Kompetenzzentren sollten öffentlich-private Geschäftspartnerschaften, Clustering und globale Kooperationen fördern, die auf Spitzenleistungen, intelligenten Strategien und Innovationen beruhen, um langfristig nachhaltig zu bleiben.

Eine der größten Herausforderungen für die Biotechnologie- und Pharmaunternehmen im 21. Jahrhundert wird die Entwicklung und Lieferung von Arzneimitteln sein, die der Biologie und Pathophysiologie des einzelnen Patienten entsprechen. Dieser Wechsel von der Blockbuster-Medizin zur personalisierten Medizin wird in hohem Maße die Art und Weise beeinflussen, wie Medikamente in Zukunft entwickelt, vermarktet und verschrieben werden. Diese Änderungen könnten ein Ende der Blockbuster-Philosophie in „Big Pharma“ bedeuten und damit wesentliche Änderungen in den Unternehmensstrukturen nach sich ziehen. Die Implementierung der personalisierten Medizin wird ein schrittweiser Prozess sein, bei dem die Aufteilung der Patienten in biologische Untergruppen der erste wichtige Schritt sein wird. Dies ist bereits heute bei mehreren Krebserkrankungen der Fall, beispielsweise bei Brustkrebs. In den kommenden Jahren werden aufgrund der Ergebnisse pharmakodiagnostischer Tests immer mehr Medikamente verschrieben. In der Krebsmedizin, die auf diesem Gebiet führend war, wird erwartet, dass in 10 bis 15 Jahren nur sehr wenige Medikamente ohne einen solchen Test verschrieben werden.


Erfolg in Open Science definieren.

Immer mehr Beweise deuten darauf hin, dass Innovationssysteme weltweit zunehmend nicht mehr nachhaltig sind. Ebenso bestehen weiterhin Bedenken hinsichtlich der Ungleichheiten im Wissenschafts- und Innovationsprozess und des Zugangs zu seinen Vorteilen. Vor dem Hintergrund wachsender gesundheitlicher, wirtschaftlicher und wissenschaftlicher Herausforderungen versuchen globale Interessengruppen dringend, Innovationen voranzutreiben und die gerechte Verteilung der Vorteile für alle zu maximieren. Die Open Science Collaboration (OS), die eine Vielzahl von Ansätzen umfasst, um die offene, öffentliche und schnelle Mobilisierung wissenschaftlicher Erkenntnisse zu verbessern, wird als einer der vielversprechendsten Wege in die Zukunft angesehen. Viele Entscheidungsträger zögern jedoch, eine Politik zu entwickeln, die die Annahme und Implementierung von Betriebssystemen unterstützt, ohne Zugang zu substanziellen, klaren und verlässlichen Beweisen zu haben.

Im Oktober 2017 versammelten sich internationale Vordenker auf einem Open Science Leadership Forum in den Büros der Bill and Melinda Gates Foundation in Washington DC, um ihre Ansichten darüber zu teilen, wie erfolgreich Open Science aussieht. Delegierte aus Industrie- und Entwicklungsländern, nationalen Regierungen, Wissenschaftsagenturen und Förderorganisationen, Philanthropie, Forschern, Patientenorganisationen und der Biotechnologie-, Pharma- und Künstlichen Intelligenz (KI) -Industrie diskutierten die Ergebnisse, die sie dazu bringen würden, in OS und darüber hinaus zu investieren Fragen der Politik und Umsetzung. Dieser erste von zwei Berichten fasst die Ansichten der Delegierten darüber zusammen, was OS ihrer Meinung nach in Bezug auf Forschung, Innovation und soziale Auswirkungen in den Biowissenschaften leisten wird.

Durch einen offenen und kollaborativen Prozess in den nächsten Monaten werden wir diese Erfolgsergebnisse in ein Toolkit quantitativer und qualitativer Indikatoren umsetzen, um zu bewerten, wann, wo und wie offene wissenschaftliche Kooperationen Forschung, Innovation und sozialen Nutzen am besten fördern. Letztendlich zielt diese Arbeit darauf ab, Instrumente zu entwickeln und offen auszutauschen, die es den Stakeholdern ermöglichen, ihre Innovationsökosysteme zu bewerten und neu zu erfinden, den Wert für die globale Öffentlichkeit und die Patienten zu maximieren und langjährige Fragen zu den Mechanismen der Innovation zu beantworten.

Chancen in der Biotechnologie.

Impfstoffherstellung und -technologie: von biotechnologischen Plattformen bis zu syntethischen Epitopen, aktueller Standpunkt.

Die Ziele: Die Überprüfung berücksichtigt die kurze Geschichte der Impfpraxis und die Entwicklung der Impfstofftechnologie. ‘In die Überprüfung beziehen wir Daten aus mehreren Monographien über die Herstellung von Impfstoffen ein, die von Autoren von Unternehmen wie Merck & Co; Sanofi Pasteur; Dynavax Europe / Rhein Biotech GmbH; Latham Biopharm Group; Aridis Pharmaceuticals LLC; Genentech; Amgen; Shamir Biologics LLC; Biopharm Services US; Novartis Pharma AG und mehrere Forschungszentren: Labor für bakterielle Polysaccharide, Zentrum für Bewertung und Forschung von Biologika; Purdue University, West Lafayette, IN, USA; Institut für Pharmazeutische Chemie, Univ. Von Kansas; Max-Planck-Institut für Dynamik komplexer technischer Systeme; Fraunhofer USA Zentrum für Molekulare Biotechnologie; US Dep. of Agriculture Tier- und Pflanzengesundheitsinspektionsdienst usw.


Impfstoffherstellung und -technologie: von biotechnologischen Plattformen bis zu syntethischen Epitopen, aktueller Standpunkt.

Die Ziele: Die Überprüfung berücksichtigt die kurze Geschichte der Impfpraxis und die Entwicklung der Impfstofftechnologie. In die Überprüfung beziehen wir Daten aus mehreren Monographien über die Herstellung von Impfstoffen ein, die von Autoren von Unternehmen wie Merck & Co; Sanofi Pasteur; Dynavax Europe / Rhein Biotech GmbH; Latham Biopharm Group; Aridis Pharmaceuticals LLC; Genentech; Amgen; Shamir Biologics LLC; Biopharm Services US; Novartis Pharma AG und mehrere Forschungszentren: Labor für bakterielle Polysaccharide, Zentrum für Bewertung und Forschung von Biologika; Purdue University, West Lafayette, IN, USA; Institut für Pharmazeutische Chemie, Univ. Von Kansas; Max-Planck-Institut für Dynamik komplexer technischer Systeme; Fraunhofer USA Zentrum für Molekulare Biotechnologie; US Dep. of Agriculture Tier- und Pflanzengesundheitsinspektionsdienst usw.

In der historischen Literatur gibt es Daten über Impfpraktiken im antiken China, Persien, Indien, Byzanz, amerikanischen Ureinwohnern und einigen afrikanischen Bevölkerungsgruppen. In der modernen Immunologie wurden die Impfstoffe seit dem Ende des 19. Jahrhunderts auf den In-vivo-Plattformen hergestellt – bei Tieren (Kaninchen, Mäusen, Kühen). Seit 1931 wurden und werden aufgrund der Entwicklung von E. Goodpasture die meisten Virusimpfstoffe auf der in ovo-Plattform hergestellt. 1949 entwickelte J. F. Enders in vitro eine Produktion von Polio-Viren in großem Maßstab in der Primärkultur von Affennierenzellen.

Lyophilized recombinant standard

ST0000-1 1ng/vial
EUR 172

FDA Standard Tissue Array

T8234701-1 1 slides
EUR 214
Description: Our tissue products are produced by strictly following the IRB ethical standards and procedures and from highest quality tissues. Immediately after collection the tissues are placed in liquid nitrogen and examined by certified pathologists. The thickness of each individual section is ~5um. They are Hematoxylin and Eosin stained and quality tested by immunostaining with anti-beta-actin antibodies. Our tissue products are suitable for various studies on cellular level (RNA localization, Protein expression, etc.) on both normal and pathological cases. It is also an excellent control and educational tool.

FDA Standard Frozen Tissue Array - Mouse Normal

T6334701-1 2 slides
EUR 599
Description: Our tissue products are produced by strictly following the IRB ethical standards and procedures and from highest quality tissues. Immediately after collection the tissues are placed in liquid nitrogen and examined by certified pathologists. The thickness of each individual section is ~5um. They are Hematoxylin and Eosin stained and quality tested by immunostaining with anti-beta-actin antibodies. Our tissue products are suitable for various studies on cellular level (RNA localization, Protein expression, etc.) on both normal and pathological cases. It is also an excellent control and educational tool.

FDA Standard Frozen Tissue Array - Rat Normal

T6434701-1 2 slides
EUR 599
Description: Our tissue products are produced by strictly following the IRB ethical standards and procedures and from highest quality tissues. Immediately after collection the tissues are placed in liquid nitrogen and examined by certified pathologists. The thickness of each individual section is ~5um. They are Hematoxylin and Eosin stained and quality tested by immunostaining with anti-beta-actin antibodies. Our tissue products are suitable for various studies on cellular level (RNA localization, Protein expression, etc.) on both normal and pathological cases. It is also an excellent control and educational tool.


abx092106-1vial 1 vial
EUR 217
  • Shipped within 5-12 working days.


abx098954-10vials 10 vials
EUR 2179
  • Shipped within 5-7 working days.


abx098954-1vial 1 vial
EUR 300
  • Shipped within 5-7 working days.


abx098954-5vials 5 vials
EUR 1177
  • Shipped within 5-7 working days.


abx098955-10vials 10 vials
EUR 2179
  • Shipped within 5-7 working days.


abx098955-1vial 1 vial
EUR 300
  • Shipped within 5-7 working days.


abx098955-5vials 5 vials
EUR 1177
  • Shipped within 5-7 working days.


abx098956-10vials 10 vials
EUR 2179
  • Shipped within 5-7 working days.


abx098956-1vial 1 vial
EUR 300
  • Shipped within 5-7 working days.


abx098956-5vials 5 vials
EUR 1177
  • Shipped within 5-7 working days.


abx098963-10vials 10 vials
EUR 2179
  • Shipped within 5-7 working days.


abx098963-1vial 1 vial
EUR 300
  • Shipped within 5-7 working days.


abx098963-5vials 5 vials
EUR 1177
  • Shipped within 5-7 working days.


abx098965-10vials 10 vials
EUR 2179
  • Shipped within 5-7 working days.


abx098965-1vial 1 vial
EUR 300
  • Shipped within 5-7 working days.


abx098965-5vials 5 vials
EUR 1177
  • Shipped within 5-7 working days.


abx098967-10vials 10 vials
EUR 2179
  • Shipped within 5-7 working days.


abx098967-1vial 1 vial
EUR 300
  • Shipped within 5-7 working days.


abx098967-5vials 5 vials
EUR 1177
  • Shipped within 5-7 working days.


abx098968-10vials 10 vials
EUR 2179
  • Shipped within 5-7 working days.


abx098968-1vial 1 vial
EUR 300
  • Shipped within 5-7 working days.


abx098968-5vials 5 vials
EUR 1177
  • Shipped within 5-7 working days.


abx098969-10vials 10 vials
EUR 2179
  • Shipped within 5-7 working days.


abx098969-1vial 1 vial
EUR 300
  • Shipped within 5-7 working days.


abx098969-5vials 5 vials
EUR 1177
  • Shipped within 5-7 working days.


abx296006-1vial 1 vial
EUR 300
  • Shipped within 5-10 working days.

FDA Standard Frozen Tissue Array - Human Adult Normal

T6234701-1 2 slides
EUR 1120
Description: Our tissue products are produced by strictly following the IRB ethical standards and procedures and from highest quality tissues. Immediately after collection the tissues are placed in liquid nitrogen and examined by certified pathologists. The thickness of each individual section is ~5um. They are Hematoxylin and Eosin stained and quality tested by immunostaining with anti-beta-actin antibodies. Our tissue products are suitable for various studies on cellular level (RNA localization, Protein expression, etc.) on both normal and pathological cases. It is also an excellent control and educational tool.

Endothelin-1 Standard, 50UL

C160-50UL 50UL
EUR 123

Human Plasma Progesterone standard (100 ng/ml)

1955-P4-1 1 ml Ask for price

Amyloid ?-Peptide (1-42) (human)

B6057-.1 100 ug
EUR 276

HIV-1 Tat Protein Peptide

B1433-1 1 mg
EUR 128
Description: HIV-1 Tat Protein Peptide

Standard G. Pig Complement serum (Lyophilized), tested for complement activity

COMPG-1 1 ml
EUR 225

Lytic Peptide, Shiva ? 1

SP-88327-1 1 mg
EUR 347

Deoxynivalenol Standard

SD010 0.5ug/mL
EUR 607

Zearalenone Standard

SD013 0.5ug/mL
EUR 523

Tetrodotoxin Standard

SD015 0.5ug/mL
EUR 607

Microcystin Standard

SD016 0.5ug/mL
EUR 523

Brain natriuretic peptide (1-32) (human)

B5442-1 1 mg
EUR 518

Amyloid Beta-Peptide (1-40) (human)

A1124-1 1 mg
EUR 189
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

YAP-TEAD Inhibitor 1 (Peptide 17)

A1149-1 1 mg
EUR 235

GnRH Associated Peptide (GAP) (1-13), human

A1020-1 1 mg
EUR 90
Description: Sequence: Asp-Ala-Glu-Asn-Leu-Ile-Asp-Ser-Phe-Gln-Glu-Ile-ValThe cloned complementary DNA sequence encoding the human gonadotropin-releasing hormone (GnRH) precursor protein was used to construct an expression vector for the bacterial synthesis of the 56-amino acid GnRH-associated peptide (GAP).

SAMS Peptide

B5097-1 1 mg
EUR 222

Rhodopsin peptide

A1087-1 1 mg
EUR 131
Description: Rhodopsin peptide,(C51H88N14O20), a peptide with the sequence H2N-Val-Ser-Lys-Thr-Glu-Thr-Ser-Gln-Val-Ala-Pro-Ala-OH, MW= 1217.33. Rhodopsin, also known as visual purple, is a biological pigment in photoreceptor cells of the retina that is responsible for the first events in the perception of light.

Peptide Standard 1 [H-Cys-Pro-Asp-Phe-Gly-His-Ile-Ala-Met-Glu-Leu-Ser-Val-Arg-Thr-Trp-Lys-Tyr-OH; MW: 2152.52]

SP-55163-1 0.5 mg
EUR 166

ExoStd? BPH-1 Fluorescent Exosome Standard

EUR 756

Canine C-Peptide ELISA Kit

DLR-C-Peptide-c-48T 48T
EUR 527
  • Should the Canine C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Canine C-Peptide ELISA Kit

DLR-C-Peptide-c-96T 96T
EUR 688
  • Should the Canine C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Human C-Peptide ELISA Kit

DLR-C-Peptide-Hu-48T 48T
EUR 398
  • Should the Human C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Human C-Peptide ELISA Kit

DLR-C-Peptide-Hu-96T 96T
EUR 511
  • Should the Human C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Mouse C-Peptide ELISA Kit

DLR-C-Peptide-Mu-48T 48T
EUR 450
  • Should the Mouse C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Mouse C-Peptide ELISA Kit

DLR-C-Peptide-Mu-96T 96T
EUR 582
  • Should the Mouse C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Rat C-Peptide ELISA Kit

DLR-C-Peptide-Ra-48T 48T
EUR 467
  • Should the Rat C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Rat C-Peptide ELISA Kit

DLR-C-Peptide-Ra-96T 96T
EUR 605
  • Should the Rat C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Canine C-Peptide ELISA Kit

RD-C-Peptide-c-48Tests 48 Tests
EUR 533

Canine C-Peptide ELISA Kit

RD-C-Peptide-c-96Tests 96 Tests
EUR 740

Human C-Peptide ELISA Kit

RD-C-Peptide-Hu-48Tests 48 Tests
EUR 387

Human C-Peptide ELISA Kit

RD-C-Peptide-Hu-96Tests 96 Tests
EUR 532

Mouse C-Peptide ELISA Kit

RD-C-Peptide-Mu-48Tests 48 Tests
EUR 446

Mouse C-Peptide ELISA Kit

RD-C-Peptide-Mu-96Tests 96 Tests
EUR 615

Rat C-Peptide ELISA Kit

RD-C-Peptide-Ra-48Tests 48 Tests
EUR 465

Rat C-Peptide ELISA Kit

RD-C-Peptide-Ra-96Tests 96 Tests
EUR 643

Canine C-Peptide ELISA Kit

RDR-C-Peptide-c-48Tests 48 Tests
EUR 557

Canine C-Peptide ELISA Kit

RDR-C-Peptide-c-96Tests 96 Tests
EUR 774

Human C-Peptide ELISA Kit

RDR-C-Peptide-Hu-48Tests 48 Tests
EUR 404

Human C-Peptide ELISA Kit

RDR-C-Peptide-Hu-96Tests 96 Tests
EUR 556

Mouse C-Peptide ELISA Kit

RDR-C-Peptide-Mu-48Tests 48 Tests
EUR 465

Mouse C-Peptide ELISA Kit

RDR-C-Peptide-Mu-96Tests 96 Tests
EUR 643

Rat C-Peptide ELISA Kit

RDR-C-Peptide-Ra-48Tests 48 Tests
EUR 486

Rat C-Peptide ELISA Kit

RDR-C-Peptide-Ra-96Tests 96 Tests
EUR 672

GLP-1 Glucagon Like Peptide-1 (31 a.a.) Human Recombinant Protein

PROTP01275-1 Regular: 50ug
EUR 317
Description: Glucagon Like Peptide-1 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 31 amino acids and having a molecular mass of 3298.7 Dalton. The GLP-1 is purified by proprietary chromatographic techniques.

Formaldehyde Standard, 500UL

C001-500UL 500UL
EUR 123

Creatinine Standard, 100UL

C003-100UL 100UL
EUR 123

Creatinine Standard, 1ML

C003-1ML 1ML
EUR 237

RBP Standard, 60UL

C009-60UL 60UL
EUR 123

RBP Standard, 240UL

C014-240UL 240UL
EUR 227

RBP Standard, 60UL

C014-60UL 60UL
EUR 123

Palladium Standard, 100UL

C016-100UL 100UL
EUR 123

Glutathione Standard, 100UL

C018-100UL 100UL
EUR 122

Glutathione Standard, 300UL

C018-300UL 300UL
EUR 123

Hemoglobin Standard, 300UL

C037-300UL 300UL
EUR 123

Cortisol Standard, 125UL

C040-125UL 125UL
EUR 123

Cortisol Standard, 625UL

C040-625UL 625UL
EUR 227

Corticosterone Standard, 125UL

C043-125UL 125UL
EUR 123

Corticosterone Standard, 625UL

C043-625UL 625UL
EUR 227

Acetylcholinesterase Standard, 225UL

C046-225UL 225UL
EUR 123

Butyrylcholinesterase Standard, 225UL

C051-225UL 225UL
EUR 123

Cortisone Standard, 125UL

C054-125UL 125UL
EUR 227

Cortisone Standard, 50UL

C054-50UL 50UL
EUR 123

Cortisone Standard, 625UL

C054-625UL 625UL
EUR 227

Osteopontin Standard, 1EA

C077-1EA 1EA
EUR 143

PGFM Standard, 125UL

C085-125UL 125UL
EUR 123

PGFM Standard, 625UL

C085-625UL 625UL
EUR 237

Nitrate Standard, 200UL

C086-200UL 200UL
EUR 123

Nitrite Standard, 200UL

C087-200UL 200UL
EUR 123

Progesterone Standard, 125UL

C092-125UL 125UL
EUR 123

Progesterone Standard, 625UL

C092-625UL 625UL
EUR 237

ANP Standard, 125UL

C095-125UL 125UL
EUR 158

ANP Standard, 625UL

C095-625UL 625UL
EUR 308

Estradiol Standard, 125UL

C103-125UL 125UL
EUR 123

Estradiol Standard, 625UL

C103-625UL 625UL
EUR 237

Estrone Standard, 125UL

C110-125UL 125UL
EUR 123

Estrone Standard, 625UL

C110-625UL 625UL
EUR 237

Testosterone Standard, 350UL

C113-350UL 350UL
EUR 237

Testosterone Standard, 70UL

C113-70UL 70UL
EUR 123

Catalase Standard, 90UL

C114-90UL 90UL
EUR 123

Glucose Standard, 90UL

C136-90UL 90UL
EUR 123

Prolactin Standard, 1EA

C139-1EA 1EA
EUR 143

Glucose Standard, 90UL

C141-90UL 90UL
EUR 123

Galactose Standard, 90UL

C146-90UL 90UL
EUR 123

Corticosterone Standard, 125UL

C151-125UL 125UL
EUR 123

Corticosterone Standard, 625UL

C151-625UL 625UL
EUR 227

Allopregnanolone Standard, 125UL

C155-125UL 125UL
EUR 123

Allopregnanolone Standard, 625UL

C155-625UL 625UL
EUR 227

Estradiol Standard, 375UL

C158-375UL 375UL
EUR 227

Estradiol Standard, 75UL

C158-75UL 75UL
EUR 122

Oxytocin Standard, 125UL

C164-125UL 125UL
EUR 123

Oxytocin Standard, 625UL

C164-625UL 625UL
EUR 237

Oxytocin Standard, 125UL

C167-125UL 125UL
EUR 123

Oxytocin Standard, 625UL

C167-625UL 625UL
EUR 227

Thyroxine Standard, 200UL

C177-200UL 200UL
EUR 227

Thyroxine Standard, 40UL

C177-40UL 40UL
EUR 123

Aldosterone Standard, 125UL

C182-125UL 125UL
EUR 123

Aldosterone Standard, 625UL

C182-625UL 625UL
EUR 227

Ceruloplasmin Standard, 20UL

C189-20UL 20UL
EUR 163

Levonorgestrel Standard, 350UL

C219-350UL 350UL
EUR 227

Levonorgestrel Standard, 70UL

C219-70UL 70UL
EUR 123

Myeloperoxidase Standard, 70UL

C225-70UL 70UL
EUR 123

Epiandrosterone Standard, 125UL

C233-125UL 125UL
EUR 123

Epiandrosterone Standard, 625UL

C233-625UL 625UL
EUR 227

Estriol Standard, 125UL

C236-125UL 125UL
EUR 123

Estriol Standard, 625UL

C236-625UL 625UL
EUR 227

Progesterone Standard, 200UL

C252-200UL 200UL
EUR 237

Progesterone Standard, 40UL

C252-40UL 40UL
EUR 123

PKA Standard, 1EA

C131-1EA 1EA
EUR 308

CHO HCP Standard

F018G 1 ml
EUR 257
  • Product category: Quality control/standard for molecular biology applications
Description: CHO HCP Standard by Cygnus Technologies is available in Europe via Gentaur.

BSA Standard E

F031E 1 ml
EUR 195
  • Product category: Quality control/standard for molecular biology applications
Description: BSA Standard E by Cygnus Technologies is available in Europe via Gentaur.

Insulin Standard G

F043G 1 ml
EUR 195
  • Product category: Quality control/standard for molecular biology applications
Description: Insulin Standard G by Cygnus Technologies is available in Europe via Gentaur.

ExoStepTM Culture + Standard

ExoS-25-CST9 25 test
EUR 726

ExoStepTM Plasma + Standard

ExoS-25-PST81 25 test
EUR 726

ExoStepTM Urine + Standard

ExoS-25-UST9 25 test
EUR 726

Standard Diluent Buffer

abx098951-20ml 20 ml
EUR 91
  • Shipped within 5-7 working days.

HiQTM Standard Agarose

A0222-020 200g
EUR 250


Bis heute wird die Primärkultur von Chiken-Embrio-Fibroblasten zur Produktion von Impfviren gegen Masern, Mumps und Tollwut in großem Maßstab verwendet. Seit dem 2000. Jahr in westlichen Ländern wurde der größte Teil der Virusimpfstoffe durch Kultivierung in kontinuierlichen Tumorzelllinien hergestellt. Die letzte Technologie ist die kostengünstigste für die Herstellung von Impfstoffen in großem Maßstab. Wir überprüfen mehrere neue biotechnologische Plattformen für die Herstellung des rekombinanten Proteins oder virusähnlicher Partikel als Impfstoffe für Untereinheiten: Pflanzensystem, Algen, Pilze, Insektenzellen usw.

Leave a Reply

Your email address will not be published. Required fields are marked *