Chancen in der Biotechnologie.

 

Strategien für die Biotechnologie müssen Möglichkeiten für Forschung, Innovation und Unternehmenswachstum berücksichtigen. Auf regionaler Ebene bieten öffentlich-private Kooperationen Potenzial für ein solches Wachstum und die Schaffung von Kompetenzzentren. Unter Berücksichtigung der jüngsten Fortschritte in Bereichen wie Genomik, Gesundheitsdiagnostik, synthetische Biologie, Geneditierung und bio-digitale Technologien werden Möglichkeiten für intelligente, strategische und spezialisierte Investitionen erörtert.

Diese Möglichkeiten beinhalten häufig konvergente oder disruptive Technologien, die beispielsweise Elemente der Pharma-Wissenschaft, der Molekularbiologie, der Bioinformatik und der Entwicklung neuartiger Geräte kombinieren, um die Biotechnologie und die Biowissenschaften zu verbessern. Analytische Anwendungen verwenden neuartige Geräte für die mobile Gesundheit, die prädiktive Diagnostik und die geschichtete Medizin. Die synthetische Biologie bietet Möglichkeiten für die Entwicklung neuer Produkte und die Steigerung der Effizienz bestehender Prozesse. Erfolgreiche Kompetenzzentren sollten öffentlich-private Geschäftspartnerschaften, Clustering und globale Kooperationen fördern, die auf Spitzenleistungen, intelligenten Strategien und Innovationen beruhen, um langfristig nachhaltig zu bleiben.

Eine der größten Herausforderungen für die Biotechnologie- und Pharmaunternehmen im 21. Jahrhundert wird die Entwicklung und Lieferung von Arzneimitteln sein, die der Biologie und Pathophysiologie des einzelnen Patienten entsprechen. Dieser Wechsel von der Blockbuster-Medizin zur personalisierten Medizin wird in hohem Maße die Art und Weise beeinflussen, wie Medikamente in Zukunft entwickelt, vermarktet und verschrieben werden. Diese Änderungen könnten ein Ende der Blockbuster-Philosophie in „Big Pharma“ bedeuten und damit wesentliche Änderungen in den Unternehmensstrukturen nach sich ziehen. Die Implementierung der personalisierten Medizin wird ein schrittweiser Prozess sein, bei dem die Aufteilung der Patienten in biologische Untergruppen der erste wichtige Schritt sein wird. Dies ist bereits heute bei mehreren Krebserkrankungen der Fall, beispielsweise bei Brustkrebs. In den kommenden Jahren werden aufgrund der Ergebnisse pharmakodiagnostischer Tests immer mehr Medikamente verschrieben. In der Krebsmedizin, die auf diesem Gebiet führend war, wird erwartet, dass in 10 bis 15 Jahren nur sehr wenige Medikamente ohne einen solchen Test verschrieben werden.

 

Erfolg in Open Science definieren.

Immer mehr Beweise deuten darauf hin, dass Innovationssysteme weltweit zunehmend nicht mehr nachhaltig sind. Ebenso bestehen weiterhin Bedenken hinsichtlich der Ungleichheiten im Wissenschafts- und Innovationsprozess und des Zugangs zu seinen Vorteilen. Vor dem Hintergrund wachsender gesundheitlicher, wirtschaftlicher und wissenschaftlicher Herausforderungen versuchen globale Interessengruppen dringend, Innovationen voranzutreiben und die gerechte Verteilung der Vorteile für alle zu maximieren. Die Open Science Collaboration (OS), die eine Vielzahl von Ansätzen umfasst, um die offene, öffentliche und schnelle Mobilisierung wissenschaftlicher Erkenntnisse zu verbessern, wird als einer der vielversprechendsten Wege in die Zukunft angesehen. Viele Entscheidungsträger zögern jedoch, eine Politik zu entwickeln, die die Annahme und Implementierung von Betriebssystemen unterstützt, ohne Zugang zu substanziellen, klaren und verlässlichen Beweisen zu haben.

Im Oktober 2017 versammelten sich internationale Vordenker auf einem Open Science Leadership Forum in den Büros der Bill and Melinda Gates Foundation in Washington DC, um ihre Ansichten darüber zu teilen, wie erfolgreich Open Science aussieht. Delegierte aus Industrie- und Entwicklungsländern, nationalen Regierungen, Wissenschaftsagenturen und Förderorganisationen, Philanthropie, Forschern, Patientenorganisationen und der Biotechnologie-, Pharma- und Künstlichen Intelligenz (KI) -Industrie diskutierten die Ergebnisse, die sie dazu bringen würden, in OS und darüber hinaus zu investieren Fragen der Politik und Umsetzung. Dieser erste von zwei Berichten fasst die Ansichten der Delegierten darüber zusammen, was OS ihrer Meinung nach in Bezug auf Forschung, Innovation und soziale Auswirkungen in den Biowissenschaften leisten wird.

Durch einen offenen und kollaborativen Prozess in den nächsten Monaten werden wir diese Erfolgsergebnisse in ein Toolkit quantitativer und qualitativer Indikatoren umsetzen, um zu bewerten, wann, wo und wie offene wissenschaftliche Kooperationen Forschung, Innovation und sozialen Nutzen am besten fördern. Letztendlich zielt diese Arbeit darauf ab, Instrumente zu entwickeln und offen auszutauschen, die es den Stakeholdern ermöglichen, ihre Innovationsökosysteme zu bewerten und neu zu erfinden, den Wert für die globale Öffentlichkeit und die Patienten zu maximieren und langjährige Fragen zu den Mechanismen der Innovation zu beantworten.

Impfstoffherstellung und -technologie: von biotechnologischen Plattformen bis zu syntethischen Epitopen, aktueller Standpunkt.

Die Ziele: Die Überprüfung berücksichtigt die kurze Geschichte der Impfpraxis und die Entwicklung der Impfstofftechnologie. ‘In die Überprüfung beziehen wir Daten aus mehreren Monographien über die Herstellung von Impfstoffen ein, die von Autoren von Unternehmen wie Merck & Co; Sanofi Pasteur; Dynavax Europe / Rhein Biotech GmbH; Latham Biopharm Group; Aridis Pharmaceuticals LLC; Genentech; Amgen; Shamir Biologics LLC; Biopharm Services US; Novartis Pharma AG und mehrere Forschungszentren: Labor für bakterielle Polysaccharide, Zentrum für Bewertung und Forschung von Biologika; Purdue University, West Lafayette, IN, USA; Institut für Pharmazeutische Chemie, Univ. Von Kansas; Max-Planck-Institut für Dynamik komplexer technischer Systeme; Fraunhofer USA Zentrum für Molekulare Biotechnologie; US Dep. of Agriculture Tier- und Pflanzengesundheitsinspektionsdienst usw.

 

Impfstoffherstellung und -technologie: von biotechnologischen Plattformen bis zu syntethischen Epitopen, aktueller Standpunkt.

Die Ziele: Die Überprüfung berücksichtigt die kurze Geschichte der Impfpraxis und die Entwicklung der Impfstofftechnologie. In die Überprüfung beziehen wir Daten aus mehreren Monographien über die Herstellung von Impfstoffen ein, die von Autoren von Unternehmen wie Merck & Co; Sanofi Pasteur; Dynavax Europe / Rhein Biotech GmbH; Latham Biopharm Group; Aridis Pharmaceuticals LLC; Genentech; Amgen; Shamir Biologics LLC; Biopharm Services US; Novartis Pharma AG und mehrere Forschungszentren: Labor für bakterielle Polysaccharide, Zentrum für Bewertung und Forschung von Biologika; Purdue University, West Lafayette, IN, USA; Institut für Pharmazeutische Chemie, Univ. Von Kansas; Max-Planck-Institut für Dynamik komplexer technischer Systeme; Fraunhofer USA Zentrum für Molekulare Biotechnologie; US Dep. of Agriculture Tier- und Pflanzengesundheitsinspektionsdienst usw.

In der historischen Literatur gibt es Daten über Impfpraktiken im antiken China, Persien, Indien, Byzanz, amerikanischen Ureinwohnern und einigen afrikanischen Bevölkerungsgruppen. In der modernen Immunologie wurden die Impfstoffe seit dem Ende des 19. Jahrhunderts auf den In-vivo-Plattformen hergestellt – bei Tieren (Kaninchen, Mäusen, Kühen). Seit 1931 wurden und werden aufgrund der Entwicklung von E. Goodpasture die meisten Virusimpfstoffe auf der in ovo-Plattform hergestellt. 1949 entwickelte J. F. Enders in vitro eine Produktion von Polio-Viren in großem Maßstab in der Primärkultur von Affennierenzellen.

Lyophilized recombinant standard
ST0000-1	BosterBio	1ng/vial	EUR 172

FDA Standard Tissue Array
T8234701-1	Biochain	1 slides	EUR 214
Description: Our tissue products are produced by strictly following the IRB ethical standards and procedures and from highest quality tissues. Immediately after collection the tissues are placed in liquid nitrogen and examined by certified pathologists. The thickness of each individual section is ~5um. They are Hematoxylin and Eosin stained and quality tested by immunostaining with anti-beta-actin antibodies. Our tissue products are suitable for various studies on cellular level (RNA localization, Protein expression, etc.) on both normal and pathological cases. It is also an excellent control and educational tool.

FDA Standard Frozen Tissue Array - Mouse Normal
T6334701-1	Biochain	2 slides	EUR 599
Description: Our tissue products are produced by strictly following the IRB ethical standards and procedures and from highest quality tissues. Immediately after collection the tissues are placed in liquid nitrogen and examined by certified pathologists. The thickness of each individual section is ~5um. They are Hematoxylin and Eosin stained and quality tested by immunostaining with anti-beta-actin antibodies. Our tissue products are suitable for various studies on cellular level (RNA localization, Protein expression, etc.) on both normal and pathological cases. It is also an excellent control and educational tool.

FDA Standard Frozen Tissue Array - Rat Normal
T6434701-1	Biochain	2 slides	EUR 599
Description: Our tissue products are produced by strictly following the IRB ethical standards and procedures and from highest quality tissues. Immediately after collection the tissues are placed in liquid nitrogen and examined by certified pathologists. The thickness of each individual section is ~5um. They are Hematoxylin and Eosin stained and quality tested by immunostaining with anti-beta-actin antibodies. Our tissue products are suitable for various studies on cellular level (RNA localization, Protein expression, etc.) on both normal and pathological cases. It is also an excellent control and educational tool.

Standard
abx098954-10vials	Abbexa	10 vials	EUR 2179
Shipped within 5-7 working days.

Standard
abx098954-1vial	Abbexa	1 vial	EUR 300
Shipped within 5-7 working days.

Standard
abx098954-5vials	Abbexa	5 vials	EUR 1177
Shipped within 5-7 working days.

Standard
abx098955-10vials	Abbexa	10 vials	EUR 2179
Shipped within 5-7 working days.

Standard
abx098955-1vial	Abbexa	1 vial	EUR 300
Shipped within 5-7 working days.

Standard
abx098955-5vials	Abbexa	5 vials	EUR 1177
Shipped within 5-7 working days.

Standard
abx098956-10vials	Abbexa	10 vials	EUR 2179
Shipped within 5-7 working days.

Standard
abx098956-1vial	Abbexa	1 vial	EUR 300
Shipped within 5-7 working days.

Standard
abx098956-5vials	Abbexa	5 vials	EUR 1177
Shipped within 5-7 working days.

Standard
abx098963-10vials	Abbexa	10 vials	EUR 2179
Shipped within 5-7 working days.

Standard
abx098963-1vial	Abbexa	1 vial	EUR 300
Shipped within 5-7 working days.

Standard
abx098963-5vials	Abbexa	5 vials	EUR 1177
Shipped within 5-7 working days.

Standard
abx098965-10vials	Abbexa	10 vials	EUR 2179
Shipped within 5-7 working days.

Standard
abx098965-1vial	Abbexa	1 vial	EUR 300
Shipped within 5-7 working days.

Standard
abx098965-5vials	Abbexa	5 vials	EUR 1177
Shipped within 5-7 working days.

Standard
abx098967-10vials	Abbexa	10 vials	EUR 2179
Shipped within 5-7 working days.

Standard
abx098967-1vial	Abbexa	1 vial	EUR 300
Shipped within 5-7 working days.

Standard
abx098967-5vials	Abbexa	5 vials	EUR 1177
Shipped within 5-7 working days.

Standard
abx098968-10vials	Abbexa	10 vials	EUR 2179
Shipped within 5-7 working days.

Standard
abx098968-1vial	Abbexa	1 vial	EUR 300
Shipped within 5-7 working days.

Standard
abx098968-5vials	Abbexa	5 vials	EUR 1177
Shipped within 5-7 working days.

Standard
abx098969-10vials	Abbexa	10 vials	EUR 2179
Shipped within 5-7 working days.

Standard
abx098969-1vial	Abbexa	1 vial	EUR 300
Shipped within 5-7 working days.

Standard
abx098969-5vials	Abbexa	5 vials	EUR 1177
Shipped within 5-7 working days.

Standard
abx092106-1vial	Abbexa	1 vial	EUR 217
Shipped within 5-12 working days.

Standard
abx296006-1vial	Abbexa	1 vial	EUR 300
Shipped within 5-10 working days.

FDA Standard Frozen Tissue Array - Human Adult Normal
T6234701-1	Biochain	2 slides	EUR 1120
Description: Our tissue products are produced by strictly following the IRB ethical standards and procedures and from highest quality tissues. Immediately after collection the tissues are placed in liquid nitrogen and examined by certified pathologists. The thickness of each individual section is ~5um. They are Hematoxylin and Eosin stained and quality tested by immunostaining with anti-beta-actin antibodies. Our tissue products are suitable for various studies on cellular level (RNA localization, Protein expression, etc.) on both normal and pathological cases. It is also an excellent control and educational tool.

Endothelin-1 Standard, 50UL
C160-50UL	Arbor Assays	50UL	EUR 123

Human Plasma Progesterone standard (100 ng/ml)
1955-P4-1	Alpha Diagnostics	1 ml	Ask for price

HIV-1 Tat Protein Peptide
B1433-1	ApexBio	1 mg	EUR 128
Description: HIV-1 Tat Protein Peptide

Amyloid ?-Peptide (1-42) (human)
B6057-.1	ApexBio	100 ug	EUR 276

Standard G. Pig Complement serum (Lyophilized), tested for complement activity
COMPG-1	Alpha Diagnostics	1 ml	EUR 225

Lytic Peptide, Shiva ? 1
SP-88327-1	Alpha Diagnostics	1 mg	EUR 347

Deoxynivalenol Standard
SD010	Unibiotest	0.5ug/mL	EUR 607

Zearalenone Standard
SD013	Unibiotest	0.5ug/mL	EUR 523

Tetrodotoxin Standard
SD015	Unibiotest	0.5ug/mL	EUR 607

Microcystin Standard
SD016	Unibiotest	0.5ug/mL	EUR 523

Amyloid Beta-Peptide (1-40) (human)
A1124-1	ApexBio	1 mg	EUR 189
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

YAP-TEAD Inhibitor 1 (Peptide 17)
A1149-1	ApexBio	1 mg	EUR 235

Brain natriuretic peptide (1-32) (human)
B5442-1	ApexBio	1 mg	EUR 518

GnRH Associated Peptide (GAP) (1-13), human
A1020-1	ApexBio	1 mg	EUR 90
Description: Sequence: Asp-Ala-Glu-Asn-Leu-Ile-Asp-Ser-Phe-Gln-Glu-Ile-ValThe cloned complementary DNA sequence encoding the human gonadotropin-releasing hormone (GnRH) precursor protein was used to construct an expression vector for the bacterial synthesis of the 56-amino acid GnRH-associated peptide (GAP).

Rhodopsin peptide
A1087-1	ApexBio	1 mg	EUR 131
Description: Rhodopsin peptide,(C51H88N14O20), a peptide with the sequence H2N-Val-Ser-Lys-Thr-Glu-Thr-Ser-Gln-Val-Ala-Pro-Ala-OH, MW= 1217.33. Rhodopsin, also known as visual purple, is a biological pigment in photoreceptor cells of the retina that is responsible for the first events in the perception of light.

SAMS Peptide
B5097-1	ApexBio	1 mg	EUR 222

Peptide Standard 1 [H-Cys-Pro-Asp-Phe-Gly-His-Ile-Ala-Met-Glu-Leu-Ser-Val-Arg-Thr-Trp-Lys-Tyr-OH; MW: 2152.52]
SP-55163-1	Alpha Diagnostics	0.5 mg	EUR 166

Canine C-Peptide ELISA Kit
DLR-C-Peptide-c-48T	DL Develop	48T	EUR 527
Should the Canine C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Canine C-Peptide ELISA Kit
DLR-C-Peptide-c-96T	DL Develop	96T	EUR 688
Should the Canine C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Human C-Peptide ELISA Kit
DLR-C-Peptide-Hu-48T	DL Develop	48T	EUR 398
Should the Human C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Human C-Peptide ELISA Kit
DLR-C-Peptide-Hu-96T	DL Develop	96T	EUR 511
Should the Human C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Mouse C-Peptide ELISA Kit
DLR-C-Peptide-Mu-48T	DL Develop	48T	EUR 450
Should the Mouse C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Mouse C-Peptide ELISA Kit
DLR-C-Peptide-Mu-96T	DL Develop	96T	EUR 582
Should the Mouse C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Rat C-Peptide ELISA Kit
DLR-C-Peptide-Ra-48T	DL Develop	48T	EUR 467
Should the Rat C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Rat C-Peptide ELISA Kit
DLR-C-Peptide-Ra-96T	DL Develop	96T	EUR 605
Should the Rat C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Canine C-Peptide ELISA Kit
RDR-C-Peptide-c-48Tests	Reddot Biotech	48 Tests	EUR 557

Canine C-Peptide ELISA Kit
RDR-C-Peptide-c-96Tests	Reddot Biotech	96 Tests	EUR 774

Human C-Peptide ELISA Kit
RDR-C-Peptide-Hu-48Tests	Reddot Biotech	48 Tests	EUR 404

Human C-Peptide ELISA Kit
RDR-C-Peptide-Hu-96Tests	Reddot Biotech	96 Tests	EUR 556

Mouse C-Peptide ELISA Kit
RDR-C-Peptide-Mu-48Tests	Reddot Biotech	48 Tests	EUR 465

Mouse C-Peptide ELISA Kit
RDR-C-Peptide-Mu-96Tests	Reddot Biotech	96 Tests	EUR 643

Rat C-Peptide ELISA Kit
RDR-C-Peptide-Ra-48Tests	Reddot Biotech	48 Tests	EUR 486

Rat C-Peptide ELISA Kit
RDR-C-Peptide-Ra-96Tests	Reddot Biotech	96 Tests	EUR 672

Canine C-Peptide ELISA Kit
RD-C-Peptide-c-48Tests	Reddot Biotech	48 Tests	EUR 533

Canine C-Peptide ELISA Kit
RD-C-Peptide-c-96Tests	Reddot Biotech	96 Tests	EUR 740

Human C-Peptide ELISA Kit
RD-C-Peptide-Hu-48Tests	Reddot Biotech	48 Tests	EUR 387

Human C-Peptide ELISA Kit
RD-C-Peptide-Hu-96Tests	Reddot Biotech	96 Tests	EUR 532

Mouse C-Peptide ELISA Kit
RD-C-Peptide-Mu-48Tests	Reddot Biotech	48 Tests	EUR 446

Mouse C-Peptide ELISA Kit
RD-C-Peptide-Mu-96Tests	Reddot Biotech	96 Tests	EUR 615

Rat C-Peptide ELISA Kit
RD-C-Peptide-Ra-48Tests	Reddot Biotech	48 Tests	EUR 465

Rat C-Peptide ELISA Kit
RD-C-Peptide-Ra-96Tests	Reddot Biotech	96 Tests	EUR 643

ExoStd? BPH-1 Fluorescent Exosome Standard
M1087-100	Biovision		EUR 756

GLP-1 Glucagon Like Peptide-1 (31 a.a.) Human Recombinant Protein
PROTP01275-1	BosterBio	Regular: 50ug	EUR 317
Description: Glucagon Like Peptide-1 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 31 amino acids and having a molecular mass of 3298.7 Dalton. The GLP-1 is purified by proprietary chromatographic techniques.

BSA (Standard Grade)
30-AB70	Fitzgerald	1 kg	EUR 899
Description: Standard Grade Bovine Serum Albumin (99% pure)

Internal Standard R46594
50R-R46594	Fitzgerald	50 mg	EUR 241
Description: Internal standard 3-(2-[4-(4-chlorobenzyl)-1-piperidinyl]ethyl)-2,4-[1h,3H]-quinazoline-dione (R46594)

Itraconazole Internal Standard
50R-R51012	Fitzgerald	50 mg	EUR 241
Description: Itraconazole chemical reference substance

Itraconazole Reference Standard
50R-R51211	Fitzgerald	50 mg	EUR 133
Description: Itraconazole chemical reference substance

HiQTM Standard Agarose
A0222-020	GenDepot	200g	EUR 250

HiQTM Standard Agarose
A0222-050	GenDepot	500g	EUR 448

Standard Diluent Buffer
abx098951-20ml	Abbexa	20 ml	EUR 91
Shipped within 5-7 working days.

Formaldehyde Standard, 500UL
C001-500UL	Arbor Assays	500UL	EUR 123

Creatinine Standard, 100UL
C003-100UL	Arbor Assays	100UL	EUR 123

Creatinine Standard, 1ML
C003-1ML	Arbor Assays	1ML	EUR 237

RBP Standard, 60UL
C009-60UL	Arbor Assays	60UL	EUR 123

RBP Standard, 240UL
C014-240UL	Arbor Assays	240UL	EUR 227

RBP Standard, 60UL
C014-60UL	Arbor Assays	60UL	EUR 123

Palladium Standard, 100UL
C016-100UL	Arbor Assays	100UL	EUR 123

Glutathione Standard, 100UL
C018-100UL	Arbor Assays	100UL	EUR 122

Glutathione Standard, 300UL
C018-300UL	Arbor Assays	300UL	EUR 123

Hemoglobin Standard, 300UL
C037-300UL	Arbor Assays	300UL	EUR 123

Cortisol Standard, 125UL
C040-125UL	Arbor Assays	125UL	EUR 123

Cortisol Standard, 625UL
C040-625UL	Arbor Assays	625UL	EUR 227

Corticosterone Standard, 125UL
C043-125UL	Arbor Assays	125UL	EUR 123

Corticosterone Standard, 625UL
C043-625UL	Arbor Assays	625UL	EUR 227

Acetylcholinesterase Standard, 225UL
C046-225UL	Arbor Assays	225UL	EUR 123

Butyrylcholinesterase Standard, 225UL
C051-225UL	Arbor Assays	225UL	EUR 123

Cortisone Standard, 125UL
C054-125UL	Arbor Assays	125UL	EUR 227

Cortisone Standard, 50UL
C054-50UL	Arbor Assays	50UL	EUR 123

 

Bis heute wird die Primärkultur von Chiken-Embrio-Fibroblasten zur Produktion von Impfviren gegen Masern, Mumps und Tollwut in großem Maßstab verwendet. Seit dem 2000. Jahr in westlichen Ländern wurde der größte Teil der Virusimpfstoffe durch Kultivierung in kontinuierlichen Tumorzelllinien hergestellt. Die letzte Technologie ist die kostengünstigste für die Herstellung von Impfstoffen in großem Maßstab. Wir überprüfen mehrere neue biotechnologische Plattformen für die Herstellung des rekombinanten Proteins oder virusähnlicher Partikel als Impfstoffe für Untereinheiten: Pflanzensystem, Algen, Pilze, Insektenzellen usw.