Menu Close

Chancen in der Biotechnologie.

Chancen in der Biotechnologie.

 

Strategien für die Biotechnologie müssen Möglichkeiten für Forschung, Innovation und Unternehmenswachstum berücksichtigen. Auf regionaler Ebene bieten öffentlich-private Kooperationen Potenzial für ein solches Wachstum und die Schaffung von Kompetenzzentren. Unter Berücksichtigung der jüngsten Fortschritte in Bereichen wie Genomik, Gesundheitsdiagnostik, synthetische Biologie, Geneditierung und bio-digitale Technologien werden Möglichkeiten für intelligente, strategische und spezialisierte Investitionen erörtert.

Diese Möglichkeiten beinhalten häufig konvergente oder disruptive Technologien, die beispielsweise Elemente der Pharma-Wissenschaft, der Molekularbiologie, der Bioinformatik und der Entwicklung neuartiger Geräte kombinieren, um die Biotechnologie und die Biowissenschaften zu verbessern. Analytische Anwendungen verwenden neuartige Geräte für die mobile Gesundheit, die prädiktive Diagnostik und die geschichtete Medizin. Die synthetische Biologie bietet Möglichkeiten für die Entwicklung neuer Produkte und die Steigerung der Effizienz bestehender Prozesse. Erfolgreiche Kompetenzzentren sollten öffentlich-private Geschäftspartnerschaften, Clustering und globale Kooperationen fördern, die auf Spitzenleistungen, intelligenten Strategien und Innovationen beruhen, um langfristig nachhaltig zu bleiben.

Eine der größten Herausforderungen für die Biotechnologie- und Pharmaunternehmen im 21. Jahrhundert wird die Entwicklung und Lieferung von Arzneimitteln sein, die der Biologie und Pathophysiologie des einzelnen Patienten entsprechen. Dieser Wechsel von der Blockbuster-Medizin zur personalisierten Medizin wird in hohem Maße die Art und Weise beeinflussen, wie Medikamente in Zukunft entwickelt, vermarktet und verschrieben werden. Diese Änderungen könnten ein Ende der Blockbuster-Philosophie in „Big Pharma“ bedeuten und damit wesentliche Änderungen in den Unternehmensstrukturen nach sich ziehen. Die Implementierung der personalisierten Medizin wird ein schrittweiser Prozess sein, bei dem die Aufteilung der Patienten in biologische Untergruppen der erste wichtige Schritt sein wird. Dies ist bereits heute bei mehreren Krebserkrankungen der Fall, beispielsweise bei Brustkrebs. In den kommenden Jahren werden aufgrund der Ergebnisse pharmakodiagnostischer Tests immer mehr Medikamente verschrieben. In der Krebsmedizin, die auf diesem Gebiet führend war, wird erwartet, dass in 10 bis 15 Jahren nur sehr wenige Medikamente ohne einen solchen Test verschrieben werden.

 

Erfolg in Open Science definieren.

Immer mehr Beweise deuten darauf hin, dass Innovationssysteme weltweit zunehmend nicht mehr nachhaltig sind. Ebenso bestehen weiterhin Bedenken hinsichtlich der Ungleichheiten im Wissenschafts- und Innovationsprozess und des Zugangs zu seinen Vorteilen. Vor dem Hintergrund wachsender gesundheitlicher, wirtschaftlicher und wissenschaftlicher Herausforderungen versuchen globale Interessengruppen dringend, Innovationen voranzutreiben und die gerechte Verteilung der Vorteile für alle zu maximieren. Die Open Science Collaboration (OS), die eine Vielzahl von Ansätzen umfasst, um die offene, öffentliche und schnelle Mobilisierung wissenschaftlicher Erkenntnisse zu verbessern, wird als einer der vielversprechendsten Wege in die Zukunft angesehen. Viele Entscheidungsträger zögern jedoch, eine Politik zu entwickeln, die die Annahme und Implementierung von Betriebssystemen unterstützt, ohne Zugang zu substanziellen, klaren und verlässlichen Beweisen zu haben.

Im Oktober 2017 versammelten sich internationale Vordenker auf einem Open Science Leadership Forum in den Büros der Bill and Melinda Gates Foundation in Washington DC, um ihre Ansichten darüber zu teilen, wie erfolgreich Open Science aussieht. Delegierte aus Industrie- und Entwicklungsländern, nationalen Regierungen, Wissenschaftsagenturen und Förderorganisationen, Philanthropie, Forschern, Patientenorganisationen und der Biotechnologie-, Pharma- und Künstlichen Intelligenz (KI) -Industrie diskutierten die Ergebnisse, die sie dazu bringen würden, in OS und darüber hinaus zu investieren Fragen der Politik und Umsetzung. Dieser erste von zwei Berichten fasst die Ansichten der Delegierten darüber zusammen, was OS ihrer Meinung nach in Bezug auf Forschung, Innovation und soziale Auswirkungen in den Biowissenschaften leisten wird.

Durch einen offenen und kollaborativen Prozess in den nächsten Monaten werden wir diese Erfolgsergebnisse in ein Toolkit quantitativer und qualitativer Indikatoren umsetzen, um zu bewerten, wann, wo und wie offene wissenschaftliche Kooperationen Forschung, Innovation und sozialen Nutzen am besten fördern. Letztendlich zielt diese Arbeit darauf ab, Instrumente zu entwickeln und offen auszutauschen, die es den Stakeholdern ermöglichen, ihre Innovationsökosysteme zu bewerten und neu zu erfinden, den Wert für die globale Öffentlichkeit und die Patienten zu maximieren und langjährige Fragen zu den Mechanismen der Innovation zu beantworten.

Chancen in der Biotechnologie.

Impfstoffherstellung und -technologie: von biotechnologischen Plattformen bis zu syntethischen Epitopen, aktueller Standpunkt.

Die Ziele: Die Überprüfung berücksichtigt die kurze Geschichte der Impfpraxis und die Entwicklung der Impfstofftechnologie. ‘In die Überprüfung beziehen wir Daten aus mehreren Monographien über die Herstellung von Impfstoffen ein, die von Autoren von Unternehmen wie Merck & Co; Sanofi Pasteur; Dynavax Europe / Rhein Biotech GmbH; Latham Biopharm Group; Aridis Pharmaceuticals LLC; Genentech; Amgen; Shamir Biologics LLC; Biopharm Services US; Novartis Pharma AG und mehrere Forschungszentren: Labor für bakterielle Polysaccharide, Zentrum für Bewertung und Forschung von Biologika; Purdue University, West Lafayette, IN, USA; Institut für Pharmazeutische Chemie, Univ. Von Kansas; Max-Planck-Institut für Dynamik komplexer technischer Systeme; Fraunhofer USA Zentrum für Molekulare Biotechnologie; US Dep. of Agriculture Tier- und Pflanzengesundheitsinspektionsdienst usw.

 

Impfstoffherstellung und -technologie: von biotechnologischen Plattformen bis zu syntethischen Epitopen, aktueller Standpunkt.

Die Ziele: Die Überprüfung berücksichtigt die kurze Geschichte der Impfpraxis und die Entwicklung der Impfstofftechnologie. In die Überprüfung beziehen wir Daten aus mehreren Monographien über die Herstellung von Impfstoffen ein, die von Autoren von Unternehmen wie Merck & Co; Sanofi Pasteur; Dynavax Europe / Rhein Biotech GmbH; Latham Biopharm Group; Aridis Pharmaceuticals LLC; Genentech; Amgen; Shamir Biologics LLC; Biopharm Services US; Novartis Pharma AG und mehrere Forschungszentren: Labor für bakterielle Polysaccharide, Zentrum für Bewertung und Forschung von Biologika; Purdue University, West Lafayette, IN, USA; Institut für Pharmazeutische Chemie, Univ. Von Kansas; Max-Planck-Institut für Dynamik komplexer technischer Systeme; Fraunhofer USA Zentrum für Molekulare Biotechnologie; US Dep. of Agriculture Tier- und Pflanzengesundheitsinspektionsdienst usw.

In der historischen Literatur gibt es Daten über Impfpraktiken im antiken China, Persien, Indien, Byzanz, amerikanischen Ureinwohnern und einigen afrikanischen Bevölkerungsgruppen. In der modernen Immunologie wurden die Impfstoffe seit dem Ende des 19. Jahrhunderts auf den In-vivo-Plattformen hergestellt – bei Tieren (Kaninchen, Mäusen, Kühen). Seit 1931 wurden und werden aufgrund der Entwicklung von E. Goodpasture die meisten Virusimpfstoffe auf der in ovo-Plattform hergestellt. 1949 entwickelte J. F. Enders in vitro eine Produktion von Polio-Viren in großem Maßstab in der Primärkultur von Affennierenzellen.

ICP-MS Internal Standard 1

CLISS-1 125ML
EUR 190.38

VOA Standard

BTEX-1 1ML
EUR 36.48

Lyophilized recombinant standard

ST0000-1 1ng/vial
EUR 206.4

FDA Standard Tissue Array

T8234701-1 1 slides
EUR 256.8
Description: Our tissue products are produced by strictly following the IRB ethical standards and procedures and from highest quality tissues. Immediately after collection the tissues are placed in liquid nitrogen and examined by certified pathologists. The thickness of each individual section is ~5um. They are Hematoxylin and Eosin stained and quality tested by immunostaining with anti-beta-actin antibodies. Our tissue products are suitable for various studies on cellular level (RNA localization, Protein expression, etc.) on both normal and pathological cases. It is also an excellent control and educational tool.

ICP-MS Instrument Calibration Standard 1

CL-CAL-1 125ML
EUR 360.24

ICP-MS Instrument Check Standard 1

CL-ICS-1 125ML
EUR 315.78

ICP-MS Initial Calibration Verification Standard 1

CL-ICV-1 125ML
EUR 371.64

Laboratory Performance Check Standard

LPC-1-100N 125ML
EUR 379.62

Laboratory Performance Check Standard

LPC-1-500N 500ML
EUR 637.26

Magnetic Cryovials, SPINE Standard

CV-1-100 100 PACK
EUR 268
Description: Magnetic Cryovials, SPINE Standard; package of 100

Magnetic Cryovials, SPINE Standard

CV-1-200 200 PACK
EUR 530
Description: Magnetic Cryovials, SPINE Standard; package of 200

Magnetic Cryovials, SPINE Standard

CV-1-50 50 PACK
EUR 135
Description: Magnetic Cryovials, SPINE Standard; package of 50

Magnetic Cryovials, SPINE Standard

CV-1-500 500 PACK
EUR 1230
Description: Magnetic Cryovials, SPINE Standard; package of 500

FDA Standard Frozen Tissue Array - Mouse Normal

T6334701-1 2 slides
EUR 718.8
Description: Our tissue products are produced by strictly following the IRB ethical standards and procedures and from highest quality tissues. Immediately after collection the tissues are placed in liquid nitrogen and examined by certified pathologists. The thickness of each individual section is ~5um. They are Hematoxylin and Eosin stained and quality tested by immunostaining with anti-beta-actin antibodies. Our tissue products are suitable for various studies on cellular level (RNA localization, Protein expression, etc.) on both normal and pathological cases. It is also an excellent control and educational tool.

FDA Standard Frozen Tissue Array - Rat Normal

T6434701-1 2 slides
EUR 718.8
Description: Our tissue products are produced by strictly following the IRB ethical standards and procedures and from highest quality tissues. Immediately after collection the tissues are placed in liquid nitrogen and examined by certified pathologists. The thickness of each individual section is ~5um. They are Hematoxylin and Eosin stained and quality tested by immunostaining with anti-beta-actin antibodies. Our tissue products are suitable for various studies on cellular level (RNA localization, Protein expression, etc.) on both normal and pathological cases. It is also an excellent control and educational tool.

Amyloid ?-Peptide (1-42) (human)

B6057-.1 100 ug
EUR 331.2

HIV-1 Tat Protein Peptide

B1433-1 1 mg
EUR 153.6
Description: HIV-1 Tat Protein Peptide

FDA Standard Frozen Tissue Array - Human Adult Normal

T6234701-1 2 slides
EUR 1344
Description: Our tissue products are produced by strictly following the IRB ethical standards and procedures and from highest quality tissues. Immediately after collection the tissues are placed in liquid nitrogen and examined by certified pathologists. The thickness of each individual section is ~5um. They are Hematoxylin and Eosin stained and quality tested by immunostaining with anti-beta-actin antibodies. Our tissue products are suitable for various studies on cellular level (RNA localization, Protein expression, etc.) on both normal and pathological cases. It is also an excellent control and educational tool.

Standard

abx092106-1vial 1 vial
EUR 260.4

Standard

abx098954-10vials 10 vials
EUR 2614.8

Standard

abx098954-1vial 1 vial
EUR 360

Standard

abx098954-5vials 5 vials
EUR 1412.4

Standard

abx098955-10vials 10 vials
EUR 2614.8

Standard

abx098955-1vial 1 vial
EUR 360

Standard

abx098955-5vials 5 vials
EUR 1412.4

Standard

abx098956-10vials 10 vials
EUR 2614.8

Standard

abx098956-1vial 1 vial
EUR 360

Standard

abx098956-5vials 5 vials
EUR 1412.4

Standard

abx098963-10vials 10 vials
EUR 2614.8

Standard

abx098963-1vial 1 vial
EUR 360

Standard

abx098963-5vials 5 vials
EUR 1412.4

Standard

abx098965-10vials 10 vials
EUR 2614.8

Standard

abx098965-1vial 1 vial
EUR 360

Standard

abx098965-5vials 5 vials
EUR 1412.4

Standard

abx098967-10vials 10 vials
EUR 2614.8

Standard

abx098967-1vial 1 vial
EUR 360

Standard

abx098967-5vials 5 vials
EUR 1412.4

Standard

abx098968-10vials 10 vials
EUR 2614.8

Standard

abx098968-1vial 1 vial
EUR 360

Standard

abx098968-5vials 5 vials
EUR 1412.4

Standard

abx098969-10vials 10 vials
EUR 2614.8

Standard

abx098969-1vial 1 vial
EUR 360

Standard

abx098969-5vials 5 vials
EUR 1412.4

Standard

abx296006-1vial 1 vial
EUR 360

Lytic Peptide, Shiva ? 1

SP-88327-1 1 mg
EUR 416.4

Amyloid Beta-Peptide (1-40) (human)

A1124-1 1 mg
EUR 226.8
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

YAP-TEAD Inhibitor 1 (Peptide 17)

A1149-1 1 mg
EUR 282

Brain natriuretic peptide (1-32) (human)

B5442-1 1 mg
EUR 621.6

Endothelin-1 Standard, 50UL

C160-50UL 50UL
EUR 147.6

Internal Standard Endosulfan-1

548-IS 1ML
EUR 37.62

Human Plasma Progesterone standard (100 ng/ml)

1955-P4-1 1 ml Ask for price

Standard G. Pig Complement serum (Lyophilized), tested for complement activity

COMPG-1 1 ml
EUR 270

Histone H3 Methylation Antibody Panel Pack I – Active Genes

C10000
  • EUR 928.26
  • EUR 588.50
  • 4 x 25 µg
  • 4 x 25 ul

Histone H3 Methylation Antibody Panel Pack I – Repression Genes

C10001
  • EUR 928.26
  • EUR 588.50
  • 4 x 25 µg
  • 4 x 25 ul

Histone H3 Methylation Antibody Panel Pack II – Active Genes

C10002
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3 Methylation Antibody Panel Pack II – Repression Genes

C10003
  • EUR 928.26
  • EUR 588.50
  • 4 x 25 µg
  • 4 x 25 ul

Histone H3 Methylation Antibody Panel Pack III – Active Genes

C10004
  • EUR 928.26
  • EUR 588.50
  • 4 x 25 µg
  • 4 x 25 ul

Histone H3K4 Methylation Antibody Panel Pack

C10005
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3K9 Methylation Antibody Panel Pack

C10006
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3K27 Methylation Antibody Panel Pack

C10007
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3K36 Methylation Antibody Panel Pack

C10008
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3K79 Methylation Antibody Panel Pack

C10009
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3 Acetylation Antibody Panel Pack I

C10010
  • EUR 928.26
  • EUR 588.50
  • 4 x 25 µg
  • 4 x 25 ul

Histone H3 Acetylation Antibody Panel Pack II

C10011
  • EUR 928.26
  • EUR 588.50
  • 4 x 25 µg
  • 4 x 25 ul

Histone H4K20 Methylation Antibody Panel Pack

C10012
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H4 Acetylation Antibody Panel Pack

C10013
  • EUR 754.26
  • EUR 470.80
  • 4 x 25 µg
  • 4 x 25 ul

Histone H3 Phosphorylation Antibody Panel Pack

C10014
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3R2 Methylation Antibody Panel Pack

C10015
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3R8 Methylation Antibody Panel Pack

C10016
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3R17 Methylation Antibody Panel Pack

C10017
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H3R26 Methylation Antibody Panel Pack

C10018
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

Histone H4R3 Methylation Antibody Panel Pack

C10019
  • EUR 754.26
  • EUR 470.80
  • 3 x 25 µg
  • 3 x 25 ul

DNA Methylation Antibody Panel Pack I

C20000
  • EUR 458.46
  • EUR 270.60
  • 2 x 25 ul

DNMT3A Protein

E11000
  • EUR 971.76
  • EUR 618.20
  • 10 µg
  • 10 ul

TET1 Protein (Active)

E12002
  • EUR 387.12
  • EUR 225.50
  • 10 µg
  • 10 ul

DNMT3B Protein 

E14000
  • EUR 971.76
  • EUR 618.20
  • 10 µg
  • 10 ul

DNMT1 Protein 

E15000
  • EUR 971.76
  • EUR 618.20
  • 10 µg
  • 10 ul

HDAC1 Protein 

E24002
  • EUR 968.28
  • EUR 616.00
  • 50 µg
  • 50 ul

HDAC10 Protein 

E24003
  • EUR 968.28
  • EUR 616.00
  • 50 µg
  • 50 ul

HDAC11 Protein 

E24004
  • EUR 968.28
  • EUR 616.00
  • 50 µg
  • 50 ul

HDAC2 Protein 

E24005
  • EUR 968.28
  • EUR 616.00
  • 50 µg
  • 50 ul

HDAC3 Protein 

E24006
  • EUR 968.28
  • EUR 616.00
  • 50 µg
  • 50 ul

HDAC4 Protein 

E24007
  • EUR 968.28
  • EUR 616.00
  • 10 µg
  • 10 ul

HDAC5 Protein 

E24008
  • EUR 968.28
  • EUR 616.00
  • 10 µg
  • 10 ul

HDAC6 Protein 

E24009
  • EUR 968.28
  • EUR 616.00
  • 50 µg
  • 50 ul

HDAC7 Protein 

E24010
  • EUR 968.28
  • EUR 616.00
  • 10 µg
  • 10 ul

HDAC8 Protein 

E24011
  • EUR 968.28
  • EUR 616.00
  • 50 µg
  • 50 ul

HDAC9 Protein 

E24012
  • EUR 968.28
  • EUR 616.00
  • 10 µg
  • 10 ul

H3F3A Protein 

E35003
  • EUR 174.84
  • EUR 78.10
  • 50 µg
  • 50 ul

H4 Protein 

E35005
  • EUR 174.84
  • EUR 78.10
  • 50 µg
  • 50 ul

SOD1 Protein 

E70000
  • EUR 599.40
  • EUR 365.20
  • 25 µg
  • 25 ul

Goat Anti-Rabbit Secondary Antibody, Biotin Conjugated

A12001
  • EUR 232.26
  • EUR 117.70
  • 350 µg
  • 350 ug

Goat Anti-Rat Secondary Antibody, Biotin Conjugated

A12002
  • EUR 232.26
  • EUR 117.70
  • 350 µg
  • 350 ug

HRP-Goat Anti-Mouse Secondary Antibody

A12003
  • EUR 232.26
  • EUR 117.70
  • 350 µg
  • 350 ug

HRP-Goat Anti-Rabbit Secondary Antibody

A12004
  • EUR 232.26
  • EUR 117.70
  • 350 µg
  • 350 ug

EpiMag HT (96-Well) Magnetic Separator

Q10002
  • EUR 416.70
  • EUR 258.50
  • 1/Pack
  • 1/Pack

EpiMag 96-Well Microplate (5/pack) 

Q10003
  • EUR 136.56
  • EUR 52.80
  • 5/pack
  • 5/pack

Human Genomic DNA 

X11000
  • Ask for price
  • EUR 235.40
  • 0.2 ml
  • 0.2 ml

Human Brain Genomic DNA  

X11001
  • Ask for price
  • EUR 77.00
  • 10 µg
  • 10 ul

GnRH Associated Peptide (GAP) (1-13), human

A1020-1 1 mg
EUR 108
Description: Sequence: Asp-Ala-Glu-Asn-Leu-Ile-Asp-Ser-Phe-Gln-Glu-Ile-ValThe cloned complementary DNA sequence encoding the human gonadotropin-releasing hormone (GnRH) precursor protein was used to construct an expression vector for the bacterial synthesis of the 56-amino acid GnRH-associated peptide (GAP).

Conductivity Standard Total Dissolved Solids as Potassium Chloride

TDS-1-500 500ML
EUR 34.2

Rhodopsin peptide

A1087-1 1 mg
EUR 157.2
Description: Rhodopsin peptide,(C51H88N14O20), a peptide with the sequence H2N-Val-Ser-Lys-Thr-Glu-Thr-Ser-Gln-Val-Ala-Pro-Ala-OH, MW= 1217.33. Rhodopsin, also known as visual purple, is a biological pigment in photoreceptor cells of the retina that is responsible for the first events in the perception of light.

SAMS Peptide

B5097-1 1 mg
EUR 266.4

epTIPS Standard 1-10ml NS

E0030000765 PK200
EUR 55.4

epTIPS Standard 1-10ml NS

E0030000781 PK200
EUR 79.8

Canine C-Peptide ELISA Kit

DLR-C-Peptide-c-48T 48T
EUR 632.4
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Canine C-Peptide ELISA Kit

DLR-C-Peptide-c-96T 96T
EUR 825.6
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Human C-Peptide ELISA Kit

DLR-C-Peptide-Hu-48T 48T
EUR 477.6
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Human C-Peptide ELISA Kit

DLR-C-Peptide-Hu-96T 96T
EUR 613.2
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Mouse C-Peptide ELISA Kit

DLR-C-Peptide-Mu-48T 48T
EUR 540
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Mouse C-Peptide ELISA Kit

DLR-C-Peptide-Mu-96T 96T
EUR 698.4
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Rat C-Peptide ELISA Kit

DLR-C-Peptide-Ra-48T 48T
EUR 560.4
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Rat C-Peptide ELISA Kit

DLR-C-Peptide-Ra-96T 96T
EUR 726
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Canine C-Peptide ELISA Kit

RD-C-Peptide-c-48Tests 48 Tests
EUR 639.6

Canine C-Peptide ELISA Kit

RD-C-Peptide-c-96Tests 96 Tests
EUR 888

Human C-Peptide ELISA Kit

RD-C-Peptide-Hu-48Tests 48 Tests
EUR 464.4

Human C-Peptide ELISA Kit

RD-C-Peptide-Hu-96Tests 96 Tests
EUR 638.4

Mouse C-Peptide ELISA Kit

RD-C-Peptide-Mu-48Tests 48 Tests
EUR 535.2

Mouse C-Peptide ELISA Kit

RD-C-Peptide-Mu-96Tests 96 Tests
EUR 738

Rat C-Peptide ELISA Kit

RD-C-Peptide-Ra-48Tests 48 Tests
EUR 558

Rat C-Peptide ELISA Kit

RD-C-Peptide-Ra-96Tests 96 Tests
EUR 771.6

Canine C-Peptide ELISA Kit

RDR-C-Peptide-c-48Tests 48 Tests
EUR 668.4

Canine C-Peptide ELISA Kit

RDR-C-Peptide-c-96Tests 96 Tests
EUR 928.8

Human C-Peptide ELISA Kit

RDR-C-Peptide-Hu-48Tests 48 Tests
EUR 484.8

Human C-Peptide ELISA Kit

RDR-C-Peptide-Hu-96Tests 96 Tests
EUR 667.2

Mouse C-Peptide ELISA Kit

RDR-C-Peptide-Mu-48Tests 48 Tests
EUR 558

Mouse C-Peptide ELISA Kit

RDR-C-Peptide-Mu-96Tests 96 Tests
EUR 771.6

Rat C-Peptide ELISA Kit

RDR-C-Peptide-Ra-48Tests 48 Tests
EUR 583.2

Rat C-Peptide ELISA Kit

RDR-C-Peptide-Ra-96Tests 96 Tests
EUR 806.4

Deoxynivalenol Standard

SD010 0.5ug/mL
EUR 728.4

Zearalenone Standard

SD013 0.5ug/mL
EUR 627.6

Tetrodotoxin Standard

SD015 0.5ug/mL
EUR 728.4

Microcystin Standard

SD016 0.5ug/mL
EUR 627.6

Internal Standard

624-I 1ML
EUR 28.5

Surrogate Standard

624-S 1ML
EUR 27.36

Internal Standard

8260-I 1ML
EUR 37.62

Surrogate Standard

8260-S 1ML
EUR 36.48

Internal Standard

5022-I 1ML
EUR 27.36

Internal Standard

507-I 1ML
EUR 137.94

Surrogate Standard

5242-S 1ML
EUR 28.5

Internal Standard

5252-I 1ML
EUR 69.54

Surrogate Standard

5252-S 1ML
EUR 44.46

Alternate Standard

CL-INT-A3 125ML
EUR 593.94

Alternate Standard

CL-INT-B2 125ML
EUR 156.18

Internal Standard

CLPS-I 1ML
EUR 98.04

BTEX Standard

BTEX 1ML
EUR 28.5

 

Bis heute wird die Primärkultur von Chiken-Embrio-Fibroblasten zur Produktion von Impfviren gegen Masern, Mumps und Tollwut in großem Maßstab verwendet. Seit dem 2000. Jahr in westlichen Ländern wurde der größte Teil der Virusimpfstoffe durch Kultivierung in kontinuierlichen Tumorzelllinien hergestellt. Die letzte Technologie ist die kostengünstigste für die Herstellung von Impfstoffen in großem Maßstab. Wir überprüfen mehrere neue biotechnologische Plattformen für die Herstellung des rekombinanten Proteins oder virusähnlicher Partikel als Impfstoffe für Untereinheiten: Pflanzensystem, Algen, Pilze, Insektenzellen usw.

Leave a Reply

Your email address will not be published. Required fields are marked *