Strategien für die Biotechnologie müssen Möglichkeiten für Forschung, Innovation und Unternehmenswachstum berücksichtigen. Auf regionaler Ebene bieten öffentlich-private Kooperationen Potenzial für ein solches Wachstum und die Schaffung von Kompetenzzentren. Unter Berücksichtigung der jüngsten Fortschritte in Bereichen wie Genomik, Gesundheitsdiagnostik, synthetische Biologie, Geneditierung und bio-digitale Technologien werden Möglichkeiten für intelligente, strategische und spezialisierte Investitionen erörtert.
Diese Möglichkeiten beinhalten häufig konvergente oder disruptive Technologien, die beispielsweise Elemente der Pharma-Wissenschaft, der Molekularbiologie, der Bioinformatik und der Entwicklung neuartiger Geräte kombinieren, um die Biotechnologie und die Biowissenschaften zu verbessern. Analytische Anwendungen verwenden neuartige Geräte für die mobile Gesundheit, die prädiktive Diagnostik und die geschichtete Medizin. Die synthetische Biologie bietet Möglichkeiten für die Entwicklung neuer Produkte und die Steigerung der Effizienz bestehender Prozesse. Erfolgreiche Kompetenzzentren sollten öffentlich-private Geschäftspartnerschaften, Clustering und globale Kooperationen fördern, die auf Spitzenleistungen, intelligenten Strategien und Innovationen beruhen, um langfristig nachhaltig zu bleiben.
Eine der größten Herausforderungen für die Biotechnologie- und Pharmaunternehmen im 21. Jahrhundert wird die Entwicklung und Lieferung von Arzneimitteln sein, die der Biologie und Pathophysiologie des einzelnen Patienten entsprechen. Dieser Wechsel von der Blockbuster-Medizin zur personalisierten Medizin wird in hohem Maße die Art und Weise beeinflussen, wie Medikamente in Zukunft entwickelt, vermarktet und verschrieben werden. Diese Änderungen könnten ein Ende der Blockbuster-Philosophie in „Big Pharma“ bedeuten und damit wesentliche Änderungen in den Unternehmensstrukturen nach sich ziehen. Die Implementierung der personalisierten Medizin wird ein schrittweiser Prozess sein, bei dem die Aufteilung der Patienten in biologische Untergruppen der erste wichtige Schritt sein wird. Dies ist bereits heute bei mehreren Krebserkrankungen der Fall, beispielsweise bei Brustkrebs. In den kommenden Jahren werden aufgrund der Ergebnisse pharmakodiagnostischer Tests immer mehr Medikamente verschrieben. In der Krebsmedizin, die auf diesem Gebiet führend war, wird erwartet, dass in 10 bis 15 Jahren nur sehr wenige Medikamente ohne einen solchen Test verschrieben werden.
Erfolg in Open Science definieren.
Immer mehr Beweise deuten darauf hin, dass Innovationssysteme weltweit zunehmend nicht mehr nachhaltig sind. Ebenso bestehen weiterhin Bedenken hinsichtlich der Ungleichheiten im Wissenschafts- und Innovationsprozess und des Zugangs zu seinen Vorteilen. Vor dem Hintergrund wachsender gesundheitlicher, wirtschaftlicher und wissenschaftlicher Herausforderungen versuchen globale Interessengruppen dringend, Innovationen voranzutreiben und die gerechte Verteilung der Vorteile für alle zu maximieren. Die Open Science Collaboration (OS), die eine Vielzahl von Ansätzen umfasst, um die offene, öffentliche und schnelle Mobilisierung wissenschaftlicher Erkenntnisse zu verbessern, wird als einer der vielversprechendsten Wege in die Zukunft angesehen. Viele Entscheidungsträger zögern jedoch, eine Politik zu entwickeln, die die Annahme und Implementierung von Betriebssystemen unterstützt, ohne Zugang zu substanziellen, klaren und verlässlichen Beweisen zu haben.
Im Oktober 2017 versammelten sich internationale Vordenker auf einem Open Science Leadership Forum in den Büros der Bill and Melinda Gates Foundation in Washington DC, um ihre Ansichten darüber zu teilen, wie erfolgreich Open Science aussieht. Delegierte aus Industrie- und Entwicklungsländern, nationalen Regierungen, Wissenschaftsagenturen und Förderorganisationen, Philanthropie, Forschern, Patientenorganisationen und der Biotechnologie-, Pharma- und Künstlichen Intelligenz (KI) -Industrie diskutierten die Ergebnisse, die sie dazu bringen würden, in OS und darüber hinaus zu investieren Fragen der Politik und Umsetzung. Dieser erste von zwei Berichten fasst die Ansichten der Delegierten darüber zusammen, was OS ihrer Meinung nach in Bezug auf Forschung, Innovation und soziale Auswirkungen in den Biowissenschaften leisten wird.
Durch einen offenen und kollaborativen Prozess in den nächsten Monaten werden wir diese Erfolgsergebnisse in ein Toolkit quantitativer und qualitativer Indikatoren umsetzen, um zu bewerten, wann, wo und wie offene wissenschaftliche Kooperationen Forschung, Innovation und sozialen Nutzen am besten fördern. Letztendlich zielt diese Arbeit darauf ab, Instrumente zu entwickeln und offen auszutauschen, die es den Stakeholdern ermöglichen, ihre Innovationsökosysteme zu bewerten und neu zu erfinden, den Wert für die globale Öffentlichkeit und die Patienten zu maximieren und langjährige Fragen zu den Mechanismen der Innovation zu beantworten.

Impfstoffherstellung und -technologie: von biotechnologischen Plattformen bis zu syntethischen Epitopen, aktueller Standpunkt.
Die Ziele: Die Überprüfung berücksichtigt die kurze Geschichte der Impfpraxis und die Entwicklung der Impfstofftechnologie. ‘In die Überprüfung beziehen wir Daten aus mehreren Monographien über die Herstellung von Impfstoffen ein, die von Autoren von Unternehmen wie Merck & Co; Sanofi Pasteur; Dynavax Europe / Rhein Biotech GmbH; Latham Biopharm Group; Aridis Pharmaceuticals LLC; Genentech; Amgen; Shamir Biologics LLC; Biopharm Services US; Novartis Pharma AG und mehrere Forschungszentren: Labor für bakterielle Polysaccharide, Zentrum für Bewertung und Forschung von Biologika; Purdue University, West Lafayette, IN, USA; Institut für Pharmazeutische Chemie, Univ. Von Kansas; Max-Planck-Institut für Dynamik komplexer technischer Systeme; Fraunhofer USA Zentrum für Molekulare Biotechnologie; US Dep. of Agriculture Tier- und Pflanzengesundheitsinspektionsdienst usw.
Impfstoffherstellung und -technologie: von biotechnologischen Plattformen bis zu syntethischen Epitopen, aktueller Standpunkt.
Die Ziele: Die Überprüfung berücksichtigt die kurze Geschichte der Impfpraxis und die Entwicklung der Impfstofftechnologie. In die Überprüfung beziehen wir Daten aus mehreren Monographien über die Herstellung von Impfstoffen ein, die von Autoren von Unternehmen wie Merck & Co; Sanofi Pasteur; Dynavax Europe / Rhein Biotech GmbH; Latham Biopharm Group; Aridis Pharmaceuticals LLC; Genentech; Amgen; Shamir Biologics LLC; Biopharm Services US; Novartis Pharma AG und mehrere Forschungszentren: Labor für bakterielle Polysaccharide, Zentrum für Bewertung und Forschung von Biologika; Purdue University, West Lafayette, IN, USA; Institut für Pharmazeutische Chemie, Univ. Von Kansas; Max-Planck-Institut für Dynamik komplexer technischer Systeme; Fraunhofer USA Zentrum für Molekulare Biotechnologie; US Dep. of Agriculture Tier- und Pflanzengesundheitsinspektionsdienst usw.
In der historischen Literatur gibt es Daten über Impfpraktiken im antiken China, Persien, Indien, Byzanz, amerikanischen Ureinwohnern und einigen afrikanischen Bevölkerungsgruppen. In der modernen Immunologie wurden die Impfstoffe seit dem Ende des 19. Jahrhunderts auf den In-vivo-Plattformen hergestellt – bei Tieren (Kaninchen, Mäusen, Kühen). Seit 1931 wurden und werden aufgrund der Entwicklung von E. Goodpasture die meisten Virusimpfstoffe auf der in ovo-Plattform hergestellt. 1949 entwickelte J. F. Enders in vitro eine Produktion von Polio-Viren in großem Maßstab in der Primärkultur von Affennierenzellen.
Lyophilized recombinant standard |
ST0000-1 |
BosterBio |
1ng/vial |
EUR 206.4 |
FDA Standard Tissue Array |
T8234701-1 |
Biochain |
1 slides |
EUR 256.8 |
Description: Our tissue products are produced by strictly following the IRB ethical standards and procedures and from highest quality tissues. Immediately after collection the tissues are placed in liquid nitrogen and examined by certified pathologists. The thickness of each individual section is ~5um. They are Hematoxylin and Eosin stained and quality tested by immunostaining with anti-beta-actin antibodies. Our tissue products are suitable for various studies on cellular level (RNA localization, Protein expression, etc.) on both normal and pathological cases. It is also an excellent control and educational tool. |
Magnetic Cryovials, SPINE Standard |
CV-1-100 |
MiTeGen |
100 PACK |
EUR 268 |
|
Description: Magnetic Cryovials, SPINE Standard; package of 100 |
Magnetic Cryovials, SPINE Standard |
CV-1-200 |
MiTeGen |
200 PACK |
EUR 530 |
|
Description: Magnetic Cryovials, SPINE Standard; package of 200 |
Magnetic Cryovials, SPINE Standard |
CV-1-50 |
MiTeGen |
50 PACK |
EUR 135 |
|
Description: Magnetic Cryovials, SPINE Standard; package of 50 |
Magnetic Cryovials, SPINE Standard |
CV-1-500 |
MiTeGen |
500 PACK |
EUR 1230 |
|
Description: Magnetic Cryovials, SPINE Standard; package of 500 |
FDA Standard Frozen Tissue Array - Mouse Normal |
T6334701-1 |
Biochain |
2 slides |
EUR 718.8 |
Description: Our tissue products are produced by strictly following the IRB ethical standards and procedures and from highest quality tissues. Immediately after collection the tissues are placed in liquid nitrogen and examined by certified pathologists. The thickness of each individual section is ~5um. They are Hematoxylin and Eosin stained and quality tested by immunostaining with anti-beta-actin antibodies. Our tissue products are suitable for various studies on cellular level (RNA localization, Protein expression, etc.) on both normal and pathological cases. It is also an excellent control and educational tool. |
FDA Standard Frozen Tissue Array - Rat Normal |
T6434701-1 |
Biochain |
2 slides |
EUR 718.8 |
Description: Our tissue products are produced by strictly following the IRB ethical standards and procedures and from highest quality tissues. Immediately after collection the tissues are placed in liquid nitrogen and examined by certified pathologists. The thickness of each individual section is ~5um. They are Hematoxylin and Eosin stained and quality tested by immunostaining with anti-beta-actin antibodies. Our tissue products are suitable for various studies on cellular level (RNA localization, Protein expression, etc.) on both normal and pathological cases. It is also an excellent control and educational tool. |
Amyloid ?-Peptide (1-42) (human) |
B6057-.1 |
ApexBio |
100 ug |
EUR 331.2 |
HIV-1 Tat Protein Peptide |
B1433-1 |
ApexBio |
1 mg |
EUR 153.6 |
Description: HIV-1 Tat Protein Peptide |
FDA Standard Frozen Tissue Array - Human Adult Normal |
T6234701-1 |
Biochain |
2 slides |
EUR 1344 |
Description: Our tissue products are produced by strictly following the IRB ethical standards and procedures and from highest quality tissues. Immediately after collection the tissues are placed in liquid nitrogen and examined by certified pathologists. The thickness of each individual section is ~5um. They are Hematoxylin and Eosin stained and quality tested by immunostaining with anti-beta-actin antibodies. Our tissue products are suitable for various studies on cellular level (RNA localization, Protein expression, etc.) on both normal and pathological cases. It is also an excellent control and educational tool. |
Amyloid Beta-Peptide (1-40) (human) |
A1124-1 |
ApexBio |
1 mg |
EUR 226.8 |
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
YAP-TEAD Inhibitor 1 (Peptide 17) |
A1149-1 |
ApexBio |
1 mg |
EUR 282 |
Brain natriuretic peptide (1-32) (human) |
B5442-1 |
ApexBio |
1 mg |
EUR 621.6 |
Standard |
abx092106-1vial |
Abbexa |
1 vial |
EUR 260.4 |
|
Standard |
abx098954-10vials |
Abbexa |
10 vials |
EUR 2614.8 |
|
Standard |
abx098954-1vial |
Abbexa |
1 vial |
EUR 360 |
|
Standard |
abx098954-5vials |
Abbexa |
5 vials |
EUR 1412.4 |
|
Standard |
abx098955-10vials |
Abbexa |
10 vials |
EUR 2614.8 |
|
Standard |
abx098955-1vial |
Abbexa |
1 vial |
EUR 360 |
|
Standard |
abx098955-5vials |
Abbexa |
5 vials |
EUR 1412.4 |
|
Standard |
abx098956-10vials |
Abbexa |
10 vials |
EUR 2614.8 |
|
Standard |
abx098956-1vial |
Abbexa |
1 vial |
EUR 360 |
|
Standard |
abx098956-5vials |
Abbexa |
5 vials |
EUR 1412.4 |
|
Standard |
abx098963-10vials |
Abbexa |
10 vials |
EUR 2614.8 |
|
Standard |
abx098963-1vial |
Abbexa |
1 vial |
EUR 360 |
|
Standard |
abx098963-5vials |
Abbexa |
5 vials |
EUR 1412.4 |
|
Standard |
abx098965-10vials |
Abbexa |
10 vials |
EUR 2614.8 |
|
Standard |
abx098965-1vial |
Abbexa |
1 vial |
EUR 360 |
|
Standard |
abx098965-5vials |
Abbexa |
5 vials |
EUR 1412.4 |
|
Standard |
abx098967-10vials |
Abbexa |
10 vials |
EUR 2614.8 |
|
Standard |
abx098967-1vial |
Abbexa |
1 vial |
EUR 360 |
|
Standard |
abx098967-5vials |
Abbexa |
5 vials |
EUR 1412.4 |
|
Standard |
abx098968-10vials |
Abbexa |
10 vials |
EUR 2614.8 |
|
Standard |
abx098968-1vial |
Abbexa |
1 vial |
EUR 360 |
|
Standard |
abx098968-5vials |
Abbexa |
5 vials |
EUR 1412.4 |
|
Standard |
abx098969-10vials |
Abbexa |
10 vials |
EUR 2614.8 |
|
Standard |
abx098969-1vial |
Abbexa |
1 vial |
EUR 360 |
|
Standard |
abx098969-5vials |
Abbexa |
5 vials |
EUR 1412.4 |
|
Standard |
abx296006-1vial |
Abbexa |
1 vial |
EUR 360 |
|
Endothelin-1 Standard, 50UL |
C160-50UL |
Arbor Assays |
50UL |
EUR 147.6 |
Histone H3 Methylation Antibody Panel Pack I – Active Genes |
C10000 |
EpiGentek |
|
|
Histone H3 Methylation Antibody Panel Pack I – Repression Genes |
C10001 |
EpiGentek |
|
|
Histone H3 Methylation Antibody Panel Pack II – Active Genes |
C10002 |
EpiGentek |
|
|
Histone H3 Methylation Antibody Panel Pack II – Repression Genes |
C10003 |
EpiGentek |
|
|
Histone H3 Methylation Antibody Panel Pack III – Active Genes |
C10004 |
EpiGentek |
|
|
Histone H3K4 Methylation Antibody Panel Pack |
C10005 |
EpiGentek |
|
|
Histone H3K9 Methylation Antibody Panel Pack |
C10006 |
EpiGentek |
|
|
Histone H3K27 Methylation Antibody Panel Pack |
C10007 |
EpiGentek |
|
|
Histone H3K36 Methylation Antibody Panel Pack |
C10008 |
EpiGentek |
|
|
Histone H3K79 Methylation Antibody Panel Pack |
C10009 |
EpiGentek |
|
|
Histone H3 Acetylation Antibody Panel Pack I |
C10010 |
EpiGentek |
|
|
Histone H3 Acetylation Antibody Panel Pack II |
C10011 |
EpiGentek |
|
|
Histone H4K20 Methylation Antibody Panel Pack |
C10012 |
EpiGentek |
|
|
Histone H4 Acetylation Antibody Panel Pack |
C10013 |
EpiGentek |
|
|
Histone H3 Phosphorylation Antibody Panel Pack |
C10014 |
EpiGentek |
|
|
Histone H3R2 Methylation Antibody Panel Pack |
C10015 |
EpiGentek |
|
|
Histone H3R8 Methylation Antibody Panel Pack |
C10016 |
EpiGentek |
|
|
Histone H3R17 Methylation Antibody Panel Pack |
C10017 |
EpiGentek |
|
|
Histone H3R26 Methylation Antibody Panel Pack |
C10018 |
EpiGentek |
|
|
Histone H4R3 Methylation Antibody Panel Pack |
C10019 |
EpiGentek |
|
|
Goat Anti-Rabbit Secondary Antibody, Biotin Conjugated |
A12001 |
EpiGentek |
|
|
Goat Anti-Rat Secondary Antibody, Biotin Conjugated |
A12002 |
EpiGentek |
|
|
HRP-Goat Anti-Mouse Secondary Antibody |
A12003 |
EpiGentek |
|
|
HRP-Goat Anti-Rabbit Secondary Antibody |
A12004 |
EpiGentek |
|
|
EpiMag HT (96-Well) Magnetic Separator |
Q10002 |
EpiGentek |
|
|
EpiMag 96-Well Microplate (5/pack) |
Q10003 |
EpiGentek |
|
|
DNA Methylation Antibody Panel Pack I |
C20000 |
EpiGentek |
|
|
Human Plasma Progesterone standard (100 ng/ml) |
1955-P4-1 |
Alpha Diagnostics |
1 ml |
Ask for price |
GnRH Associated Peptide (GAP) (1-13), human |
A1020-1 |
ApexBio |
1 mg |
EUR 108 |
Description: Sequence: Asp-Ala-Glu-Asn-Leu-Ile-Asp-Ser-Phe-Gln-Glu-Ile-ValThe cloned complementary DNA sequence encoding the human gonadotropin-releasing hormone (GnRH) precursor protein was used to construct an expression vector for the bacterial synthesis of the 56-amino acid GnRH-associated peptide (GAP). |
Histone H4 peptide (1-21), Biotin-labeled |
52018-1 |
BPS Bioscience |
2.5 nmole |
EUR 90 |
Description: Histone H4 peptide, amino acids 1 to 21, acetylated at the N-terminus and biotinylated on the side chain of Lys. A GG spacer has been added on the C-terminus of Lys. |
Standard G. Pig Complement serum (Lyophilized), tested for complement activity |
COMPG-1 |
Alpha Diagnostics |
1 ml |
EUR 270 |
Rhodopsin peptide |
A1087-1 |
ApexBio |
1 mg |
EUR 157.2 |
Description: Rhodopsin peptide,(C51H88N14O20), a peptide with the sequence H2N-Val-Ser-Lys-Thr-Glu-Thr-Ser-Gln-Val-Ala-Pro-Ala-OH, MW= 1217.33. Rhodopsin, also known as visual purple, is a biological pigment in photoreceptor cells of the retina that is responsible for the first events in the perception of light. |
SAMS Peptide |
B5097-1 |
ApexBio |
1 mg |
EUR 266.4 |
Canine C-Peptide ELISA Kit |
DLR-C-Peptide-c-48T |
DL Develop |
48T |
EUR 632.4 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Canine C-Peptide ELISA Kit |
DLR-C-Peptide-c-96T |
DL Develop |
96T |
EUR 825.6 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Human C-Peptide ELISA Kit |
DLR-C-Peptide-Hu-48T |
DL Develop |
48T |
EUR 477.6 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Human C-Peptide ELISA Kit |
DLR-C-Peptide-Hu-96T |
DL Develop |
96T |
EUR 613.2 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Mouse C-Peptide ELISA Kit |
DLR-C-Peptide-Mu-48T |
DL Develop |
48T |
EUR 540 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Mouse C-Peptide ELISA Kit |
DLR-C-Peptide-Mu-96T |
DL Develop |
96T |
EUR 698.4 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Rat C-Peptide ELISA Kit |
DLR-C-Peptide-Ra-48T |
DL Develop |
48T |
EUR 560.4 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Rat C-Peptide ELISA Kit |
DLR-C-Peptide-Ra-96T |
DL Develop |
96T |
EUR 726 |
|
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Canine C-Peptide ELISA Kit |
RD-C-Peptide-c-48Tests |
Reddot Biotech |
48 Tests |
EUR 639.6 |
Canine C-Peptide ELISA Kit |
RD-C-Peptide-c-96Tests |
Reddot Biotech |
96 Tests |
EUR 888 |
Human C-Peptide ELISA Kit |
RD-C-Peptide-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 464.4 |
Human C-Peptide ELISA Kit |
RD-C-Peptide-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 638.4 |
Mouse C-Peptide ELISA Kit |
RD-C-Peptide-Mu-48Tests |
Reddot Biotech |
48 Tests |
EUR 535.2 |
Mouse C-Peptide ELISA Kit |
RD-C-Peptide-Mu-96Tests |
Reddot Biotech |
96 Tests |
EUR 738 |
Rat C-Peptide ELISA Kit |
RD-C-Peptide-Ra-48Tests |
Reddot Biotech |
48 Tests |
EUR 558 |
Rat C-Peptide ELISA Kit |
RD-C-Peptide-Ra-96Tests |
Reddot Biotech |
96 Tests |
EUR 771.6 |
Canine C-Peptide ELISA Kit |
RDR-C-Peptide-c-48Tests |
Reddot Biotech |
48 Tests |
EUR 668.4 |
Canine C-Peptide ELISA Kit |
RDR-C-Peptide-c-96Tests |
Reddot Biotech |
96 Tests |
EUR 928.8 |
Human C-Peptide ELISA Kit |
RDR-C-Peptide-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 484.8 |
Human C-Peptide ELISA Kit |
RDR-C-Peptide-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 667.2 |
Mouse C-Peptide ELISA Kit |
RDR-C-Peptide-Mu-48Tests |
Reddot Biotech |
48 Tests |
EUR 558 |
Mouse C-Peptide ELISA Kit |
RDR-C-Peptide-Mu-96Tests |
Reddot Biotech |
96 Tests |
EUR 771.6 |
Rat C-Peptide ELISA Kit |
RDR-C-Peptide-Ra-48Tests |
Reddot Biotech |
48 Tests |
EUR 583.2 |
Rat C-Peptide ELISA Kit |
RDR-C-Peptide-Ra-96Tests |
Reddot Biotech |
96 Tests |
EUR 806.4 |
GLP-1 Glucagon Like Peptide-1 (31 a.a.) Human Recombinant Protein |
PROTP01275-1 |
BosterBio |
Regular: 50ug |
EUR 380.4 |
Description: Glucagon Like Peptide-1 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 31 amino acids and having a molecular mass of 3298.7 Dalton. The GLP-1 is purified by proprietary chromatographic techniques. |
SARS-CoV-2 Spike S1 (13-665) Protein, Fc Fusion, Avi-tag |
E80020 |
EpiGentek |
|
|
SARS-CoV-2 Spike S1 (16-685) Protein, Avi-His-tag |
E80021 |
EpiGentek |
|
|
SARS-CoV-2 Spike S1 (16-685) Protein, Fc Fusion, Avi-tag |
E80022 |
EpiGentek |
|
|
SARS-CoV-2 Spike S1 RBD (V367F) Protein, Avi-His-tag |
E80023 |
EpiGentek |
|
|
SARS-CoV-2 Spike S1 RBD Protein, Avi-His-tag |
E80024 |
EpiGentek |
|
|
SARS-CoV-2 Spike S1 RBD Protein, Human Fc-Fusion, Avi-Tag |
E80025 |
EpiGentek |
|
|
SARS-CoV-2 Spike S1 RBD Protein, Mouse Fc-fusion |
E80026 |
EpiGentek |
|
|
SARS-CoV-2 Nucleocapsid Protein, Avi-His-tag |
E80027 |
EpiGentek |
|
|
Recombinant SARS-CoV-2 Spike Glycoprotein(S) (D614G), Partial |
E80028 |
EpiGentek |
|
|
Cadherin Peptide, avian |
A1028-1 |
ApexBio |
1 mg |
EUR 122.4 |
Description: Cadherin Peptide, avian, (C44H75N17O13), a peptide with the sequence Leu-Arg-Ala-His-Ala-Val-Asp-Val-Asn-Gly-NH2, MW= 1050.2. Cadherins (named for "calcium-dependent adhesion") are a class of type-1 transmembrane proteins. |
Dynamin inhibitory peptide |
A1046-1 |
ApexBio |
1 mg |
EUR 226.8 |
Description: Dynamin Inhibitory Peptide is a peptide (Gln-Val-Pro-Ser-Arg-Pro-Asn-Arg-Ala-Pro) inhibitor of the GTPase dynamin.Dynamin is a 100-kDa large GTPase that functions to tabulate membranes and liberate nascent vesicles from the Golgi apparatus and plasma membrane. |
DAPK Substrate Peptide |
A4469-1 |
ApexBio |
1 mg |
EUR 350.4 |
Description: Synthetic peptide substrate for death associated protein kinase (DAPK) (Km = 9 ?M). |
Calcineurin Autoinhibitory Peptide |
A4532-1 |
ApexBio |
1 mg |
EUR 478.8 |
Description: Selective inhibitor of Ca2+-calmodulin-dependent protein phosphatase (calcineurin) (IC50 ~ 10 mM). Does not inhibit PP1, PP2A or CaM kinase II (IC50 > 100 mM). |
Bis heute wird die Primärkultur von Chiken-Embrio-Fibroblasten zur Produktion von Impfviren gegen Masern, Mumps und Tollwut in großem Maßstab verwendet. Seit dem 2000. Jahr in westlichen Ländern wurde der größte Teil der Virusimpfstoffe durch Kultivierung in kontinuierlichen Tumorzelllinien hergestellt. Die letzte Technologie ist die kostengünstigste für die Herstellung von Impfstoffen in großem Maßstab. Wir überprüfen mehrere neue biotechnologische Plattformen für die Herstellung des rekombinanten Proteins oder virusähnlicher Partikel als Impfstoffe für Untereinheiten: Pflanzensystem, Algen, Pilze, Insektenzellen usw.